CAZyme Information: MGYG000002403_01575

Basic Information

• Species: Robinsoniella peoriensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella peoriensis
• CAZyme ID: MGYG000002403_01575
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834	MGYG000002403_52|CGC1	97773.18	4.8837

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002403	7202103	Isolate	not provided	not provided

• Gene Location: Start: 15254; End: 17758 Strand: +

Full Sequence      

MIRLELNHGWKMRPLGEAFQEAVVPGSVYTDLLRNGNMEDPFFKDNEIRAKKLMNKDYEY
VCRFVYEPEDFKDCERILLHFDGLDTLADIYVNSQKAGEAFSMHRIWEYEVQDILKAGEN
ELKVVFHSPLQFLAEAYEKYGNIGNEDTVEGFMHLRKAHYMFGWDWGACLPDAGIFRPVS
LLGIHSARIDNVRIHQEHESGQAVLTFSVEAEQNKKRDGHSCNTNRTADKNLIRAEHSNQ
EGLHYTILISDPDGRILCEESETDRFTVDHPRLWWPNGIGEQPLYEIKVMLYDGDEVLDI
WQRKIGLRTMTVRREKDQWGESFAHEINGKTIFAMGADYIPEDHLVGRTSRERTYRLLEQ
CRLANFNSVRIWGGGYYPEDWFFDACDEMGLVVWEDFMFACSVYELTPEFEANIREEFIT
NIKRIRHHASLGLWCGNNEMEMFVEQRCWVTKPTEVRDYLFMYEKMIPEVLKEHDPDTFY
WPASPSSGGSFDYPNDPDRGDVHYWEVWHGNKPFSEYRKYYFRYISEFGFQSLPSLKTLE
EITDDPKDLNLFSYVCEKHERNNGGNGKIVKYMQQMYLYPTSFSTLIYASQLLQADGIRY
GVEHFRRNRGRCMGTVFWQLNDCWPVISWSAIDSSGRWKALLYYAKRFFAPFMISCEEES
WMTQEADMNRQHFHFEKSIRLNAANETLTERTVKVRWALRNADAAILRLMEETIKVPALS
AVWMDKVELPDLDYMNEYVSYEAEENGVVISEGTVLFTYPKYFHFQDPGLTLRTEGDDIV
VRADAYAKSVEILNEEEDLVLSDNYFDMNAGERRVTVISGRTRGLRVRSVYDIH

Enzyme Prediction     

No EC number prediction in MGYG000002403_01575.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	717	1.1e-99	0.6901595744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.52e-95	6	807	15	799	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	7.15e-17	68	439	120	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	6.96e-14	9	439	33	417	beta-D-glucuronidase; Provisional
pfam17753	Ig_mannosidase	5.75e-11	767	832	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	7.55e-10	679	762	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU78706.2	0.0	10	833	40	848
ASU31771.1	0.0	10	833	40	848
QQQ95478.1	0.0	12	833	1	807
QJU17896.1	0.0	12	833	1	807
AWY97345.1	0.0	5	833	5	810

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	4.32e-141	6	819	11	817	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	4.56e-141	6	819	13	819	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	4.68e-141	6	819	13	819	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.23e-140	6	819	11	817	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	5.02e-139	6	819	11	817	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4WAH4	1.73e-110	6	824	9	834	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
A1D911	3.37e-110	6	824	9	834	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
B0YBU9	6.57e-110	6	824	9	834	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
Q5B7W2	4.65e-109	6	823	9	831	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A1CGA8	7.01e-108	3	824	6	834	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002403_01575.