CAZyme Information: MGYG000002403_02357

Basic Information

• Species: Robinsoniella peoriensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella peoriensis
• CAZyme ID: MGYG000002403_02357
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1929	MGYG000002403_69|CGC1	209594.35	4.1819

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002403	7202103	Isolate	not provided	not provided

• Gene Location: Start: 27928; End: 33717 Strand: +

Full Sequence      

MKESRKKRRRVSSAAAFCLAASMVVTNMQTAVAFAAENSGGTAASEEQLIMEQTEVNLEK
MPETEMVGERSAVETNEEKGESKEKLSEIPASIPEPEQETQGIRTAEDGNTGTFLFGTKP
VNGVTSKNLYSEETGFGFSDLTYPEEAAGWQGNVYYPRNASITTGSAAYVTDEQSYLRIA
SQVWTETENTGYGVYTYENTSTLDVKLEAKDYDVTVELVNPTDMDYSASLEAEDITKASD
VAVPAGSRKTVTFHTCLIDGVLNLKFLADSKAVSAEEAAEQAVYVESMKIEASAEKAAGD
KPTIFLASDSTVQTYEDYYDPQTGWGEALHNFFGNYIGEGPCDDCNYSQSRSYETDQVII
ENRAIGGRSSRSFIEEGKLDDLLEDVKPGDYLLVQWGHNDATSSRPNRYVSPEDFGKWIQ
YYIDGASQRGASCILVTPAARYSYNADGTFNENFKAYGDVMRSIAAQENIPLADLSAASI
ALCESFGIEGAKSLFLWVEPGEYTGAYAGGATDSTHLQYYGAYKFAQCVAKEISEISQPE
DPTISRLQSLINLKESASVPQAVTGLMPITIGASSVSMQWNASQGAEMYYIFREELTEGA
AADTIDFTNAEKYSVTAGTRYTDNGCEGGRNYVYAVCGYNDKGLGEMSENLTVTTKSAQY
KYDFNYNNSPTMEGWTGVNQNQGYTKEAGYGWIKAPNNGRNRAGNGNADSSAMADDFNLG
EGEFAVDLPNGDYEIKVYAGDLLPGTSTIKASYTAEGKAAGGISTKQALASMAASVRVMD
GQLNLTVGGSNPYINGLEITPVLLAPSGLNYSEMSIEGNSASFLIGFTGVGEAAAYRIYQ
KGQADEKFTMVKSFTAEEYQTDELSCRSMKASLGETYQYYITALGTDGTESAPSNTIEID
MLDPGVKKPAPPANIKCDSAKNGEIKLSWDSTDTAFKYMVYRSDKSEDEKGFKEFKKVGE
TQVPGFTDTGDDLTANIPYYYKIKAVNAGGAGEFSKVCKTEVTGELIASPAETLTDRGAI
AINLAGADGGETVVTASDAAGKEYTSGVYLSWRSFEKDPKGTTFNIYRNETKIAENLSVT
NLVDEGGTASDIYRVEGSSDEELGLKVLDTAVWQDKYLELKLYSPADQTMPDGTACTYSA
NDMSVGDLDGDGQLELVVKWYPSNAQDNSAKGYTGTTFLDGYDVNFATGEVSLLWRIDMG
VNIRSGAHYTQFQVWDFDGDGKAEIAVKTADGTTSYQSTDGTDAGLVEKAYVGACNAASL
PTDQISKAHDYRNGTGYILEGPEYFTMFNCDDASLIDTVDYEPGRGNVNAWGDGYGNRVD
RFLSAVAYLNGTTPSAVFCRGYYTRTCLTAYNLADTDGDGVGDKIKTFWKFDTNEAGSQY
EAQGNHGLSVNDIDNDGKDEIIYGALVIDHNGTVKYSTGQGHGDAMHVSDWVNWNEGLEV
MAVHEHDDASYHVEIHDAETGKILMGYHVGRDTGRGVAADIDPTASGAEFWSIASPNSSA
EEEPSWDSRDGGVYSTMSTLENLITLAEKSPASNASIFWDGDLLSEIQDHRFDSGAYKPI
AVNLTKWDYENNQEVTLFDSTQILSNNGTKGNTGLTADILGDWREEIISRCSSDQNRIRI
YASTIQTDYVVPCLLENRAYRQGVAWQNVAYNQPANLSYLLSEGLITAQLTAQEDKTASD
SLTFTFTPASDGVRGHEIAGYEIYRSEDGKTYKLIDTVSADRNQEVYSYTDKNLETDTMY
FYKTAAVVDGKTSYMSKPLEMKTKRKAAEVLYRFDFGISNDKAAEGWIGITVNGKGGSKT
NDELGITYSKEKKFGFADGANIITGRSEDYICDQGEIPADVYQDFALPDGNTFCVDVPNG
TYQVDIVGGSAYKSTVKGDLEGTVAVKVENGANSYTVGTYEVEVTDGQLNFNCAPKSISR
LDAMIITRI

Enzyme Prediction     

No EC number prediction in MGYG000002403_02357.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	1045	1667	1.3e-214	0.9588336192109777
CE12	303	533	7.7e-62	0.9952380952380953

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	0.0	1016	1659	5	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
cd01821	Rhamnogalacturan_acetylesterase_like	2.82e-61	302	533	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
COG3401	FN3	4.31e-21	653	1001	28	342	Fibronectin type 3 domain [General function prediction only].
pfam18370	RGI_lyase	1.28e-13	1045	1096	16	69	Rhamnogalacturonan I lyases beta-sheet domain. This is the beta-sheet domain found in rhamnogalacturonan (RG) lyases, which are responsible for an initial cleavage of the RG type I (RG-I) region of plant cell wall pectin. Polysaccharide lyase family 11 carrying this domain, such as YesW (EC:4.2.2.23) and YesX (EC:4.2.2.24), cleave glycoside bonds between rhamnose and galacturonic acid residues in RG-I through a beta-elimination reaction. Other family members carrying this domain are hemagglutinin A, lysine gingipain (Kgp) and Chitinase C (EC:3.2.1.14).
COG2755	TesA	1.88e-12	302	536	9	211	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ93926.1	0.0	106	1929	43	2107
ADL33943.1	0.0	107	1929	158	1992
QYR24106.1	1.00e-317	201	1667	56	1388
AYA78488.1	4.84e-317	101	1711	11	1461
QNF30995.1	1.76e-315	205	1665	90	1415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZUY_A	1.10e-163	1047	1665	23	593	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]
4CAG_A	9.43e-163	1046	1669	25	583	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2Z8R_A	6.48e-155	1047	1665	20	572	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
2O14_A	1.15e-15	195	495	72	335	X-RayCrystal Structure of Protein YXIM_BACsu from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR595 [Bacillus subtilis]
1DEO_A	1.03e-07	303	450	2	121	RHAMNOGALACTURONANACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.55 A RESOLUTION WITH SO4 IN THE ACTIVE SITE [Aspergillus aculeatus],1DEX_A RHAMNOGALACTURONAN ACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.9 A RESOLUTION [Aspergillus aculeatus],1K7C_A Rhamnogalacturonan acetylesterase with seven N-linked carbohydrate residues distributed at two N-glycosylation sites refined at 1.12 A resolution [Aspergillus aculeatus],1PP4_A The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus],1PP4_B The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31527	4.63e-163	1047	1665	23	593	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1
O31526	9.06e-154	1047	1665	57	609	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31528	1.27e-39	304	539	5	208	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
O31523	5.05e-37	304	546	8	226	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
P42304	6.66e-16	195	496	87	351	Uncharacterized esterase YxiM OS=Bacillus subtilis (strain 168) OX=224308 GN=yxiM PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000404	0.998809	0.000192	0.000225	0.000174	0.000155

TMHMM  Annotations     

start	end
13	35