CAZyme Information: MGYG000002403_02637

Basic Information

• Species: Robinsoniella peoriensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella peoriensis
• CAZyme ID: MGYG000002403_02637
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase catalytic subunit [UDP-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
595	MGYG000002403_74|CGC4	67776.64	7.1223

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002403	7202103	Isolate	not provided	not provided

• Gene Location: Start: 81505; End: 83292 Strand: +

Full Sequence      

MITFIYIIWRVTVIPTASIMELCLGVLLLGGELLGIAQFLISQLLLSRKYKLKKKSLDDF
GGHIPTVDIFICTYNEGEDLVETTVLAALNLDYPRDNLNIYICDDGQRRYMKRLAARCGV
NYMTRGSNEGAKAGNLNNALLHSSGELFAVLDADMICSKNFLKHTVGYFSDAETAFVQTP
QVYYNKDMYQRNLGREIPNEQDFFMREIQESRAAVGAVLHVGTNAVFRRDSIMDIGMYPT
NTITEDMAVGMLLQAAGYQSVFINEVLVLGLTASTYTDLVIQRDRWCRGNIQTSREYHPL
RMKGLSNWQKLAYLGGDIYWYTGFSKLIFTFCPIWFLLTTKLAMQADLAGILTFFLPFFI
GQMTSFYAMISNTRSLKWAHYYEIAMAPHMCLSVLREFFSASLNFAVTPKEMRDDRSHFQ
AQVILPHMVIAAITLFSWITGGLFLHLGYITLIPFVVNLVWSIYNFMGIVICIRVAYHIG
NTPRSDYSTVKSGHKITVETETESYPGEVMSFLESGMYIHVQAPLYFTKVRIRMQYQDLD
VYLDGTLKMSGSQGLFKYDWLNLNQKRAIVGVYVEHLQPSFNVEKTMIYLDSASC

Enzyme Prediction     

No EC number prediction in MGYG000002403_02637.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	68	235	5.1e-29	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	2.27e-100	65	293	1	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	6.96e-72	65	465	260	665	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	6.42e-50	39	472	27	430	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	1.04e-31	74	297	7	235	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
cd06437	CESA_CaSu_A2	2.71e-31	65	289	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPJ85522.1	5.58e-177	2	590	35	642
QPJ85521.1	2.98e-174	6	591	43	647
CED93608.1	7.81e-174	5	590	37	624
CDM68038.1	4.45e-151	5	581	43	628
QJA08755.1	5.52e-150	6	397	38	431

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.05e-55	65	465	273	678	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	5.45e-49	64	411	127	497	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.01e-48	64	411	139	509	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.02e-48	64	411	140	510	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
6YV7_B	1.56e-08	65	261	42	237	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9WX61	4.86e-58	6	475	89	566	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
Q8Z291	2.33e-56	65	465	273	678	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
Q93IN2	3.18e-56	65	465	273	678	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
P58931	3.92e-56	65	570	159	672	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2
Q9RBJ2	5.41e-56	6	491	86	579	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999532	0.000525	0.000002	0.000001	0.000001	0.000002

TMHMM  Annotations     

start	end
7	29
317	339
348	370
385	407
428	450
455	477