CAZyme Information: MGYG000002404_03755

Basic Information

• Species: Bacillus_BE massilionigeriensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Bacillus_BE; Bacillus_BE massilionigeriensis
• CAZyme ID: MGYG000002404_03755
• CAZy Family: GT14
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293	MGYG000002404_1|CGC26	35022.45	9.32

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002404	4212889	Isolate	not provided	not provided

• Gene Location: Start: 3761956; End: 3762837 Strand: -

Full Sequence      

MKKHAYLIMAHNNFRVLEILIRLLDDESNDIYLHVDLKVSIFDKEYFSKIPQKSNIYFID
RMKVNWGGLSQVICEISLLEKAISQNYKYYHLLSGVDLPIKSQKYIHNFFEQNYGKEFVG
IEKDWDKSRVKYFHLFNEIGRKKDFLSIIKRLLNSIIIQTQKKLCIVRNKNINFAKGANW
FSITHNLAEFTIRKKDDIYKLYANTIFCDEVFLQTLIINSYFKRNLYGESSSNEYDMNMR
HIDWSKGNPYIFRVNDFNELMSSNKLFARKFDENVDMDIVNMIYDEITSKSMK

Enzyme Prediction     

No EC number prediction in MGYG000002404_03755.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT14	5	250	2.8e-53	0.948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02485	Branch	4.13e-18	5	260	2	249	Core-2/I-Branching enzyme. This is a family of two different beta-1,6-N-acetylglucosaminyltransferase enzymes, I-branching enzyme and core-2 branching enzyme. I-branching enzyme is responsible for the production of the blood group I-antigen during embryonic development. Core-2 branching enzyme forms crucial side-chain branches in O-glycans. This is a fmmily of glycosyl-transferases that are Type II membrane proteins that are found in the endoplasmic reticulum (ER) and Golgi apparatus.
PLN03183	PLN03183	1.09e-04	177	274	256	353	acetylglucosaminyltransferase family protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMN32012.1	1.86e-84	2	290	3	296
QUD73698.1	1.86e-84	2	290	3	296
APF22740.1	4.29e-82	2	288	3	292
QNM12695.1	2.81e-79	4	283	2	278
ALV21388.1	1.99e-77	1	293	1	300

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OTK_A	5.88e-06	5	293	87	387	Structureand mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_B Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_C Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus],3OTK_D Structure and mechanisim of core 2 beta1,6-n-acetylglucosaminyltransferase: a Metal-ion independent gt-a glycosyltransferase [Mus musculus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002404_03755.