CAZyme Information: MGYG000002406_00124

Basic Information

• Species: Corynebacterium pacaense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium pacaense
• CAZyme ID: MGYG000002406_00124
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1603	MGYG000002406_12|CGC2	171495.56	4.2681

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002406	3028764	Isolate	not provided	not provided

• Gene Location: Start: 85565; End: 90376 Strand: -

Full Sequence      

MTTDQVRTWLRDWVVRTTGLPEEEVSDDKAMETFGLSSRDVVVLSGELENLLDVSLDATI
AYEYPTIRDLARRLVDGEPARTGSARPLSFSTNGDAAETPGTHDIAVVGMAARFPGAENI
EEMWKLLIEGRDGIGELPIGRWSEYAGDEVMSKKMEEYSTVGGYLPDISSFDAEFFGLSP
LEAANMDPQQRILLELTWEALESARIAPNELRGEPVGVFMGSTNNDYGMLITADPAEAHP
YALTGTSSAIVANRINYVFDFRGPSISVDTACSSSLVAVHQAIRALRTGEADHAVAGGVN
ILASPFVTTAFAELGVISPSGRIHAFSDDADGFVRSDGAGVIVLKRVDDAIRDGDEILAV
LKGSAVNSDGHSNGLTAPNPDAQIDVLQRAYVDARVDPTTVDYIEAHGTGTILGDPIEAT
ALGAVLGHGRSAENPALLGSAKSNFGHTEAAAGIAGIIKVVLAMRNRTLPPSVNFSGPNR
YIDFDAEHLEVVEDPREWPEYSERPTAGVSAFGFGGTNAHVVVTDFDSSAYGRASVQKAA
QLPDEVVALPVSGHLPSRRRQAAADLAEFLSGRTDADLIPVARALARRNHGRSRAVVLAG
TVDDAINRLLKVAEGKVSVGIAAADAPAANGPVFVYSGFGSQHRKMIKDLCSTSPHFRER
IEELDEMVKFESGWSIMDIVLDDEQTYDTETAQVAITAIQIALTDLLAEFGVRPAAVMGM
SMGEIAAGYASGGLSDSDAMLIASHRSRLMGEGEKSLSEDELGAMAVVEFSPESLDAFID
TNPEYAGIEPAVYAGPGMTTVGGPREAVVALVEKLEAEGKFARLLNVRGAGHTSAVEPLL
GELAGEIAGVEAKPLRIPLFSSVDKGVIYRPGAVVHDADYMLRCTRNPVYFQDATEAAFS
EGYNTLVEISPNPVALMGMMNTAFSVGRPDAQLLFVLKRKVPEAETIRDLLSKLYVNGEP
VDFAPLYGDGEIIDPPHITWKHQRFWTSARPSSGDRRELPGTRVTLPNNTVAFTTVAEMV
PSAVAVMETAAEAVLRGSTLVAADERDSLPPSGEITTLVSRHLGGLSLSVYKVHGDVTSL
VAEGFATTGGFGAVTPPLESEVEEPDSALSDLPLDVEAVRWDPDTETVEQRMKAIVSEAM
GYDVDDLPRELPLIDLGLDSLMGMRIKNRIENDFQIPPLQVQALRDASVADVVHLVEDLV
AGQQLDDAPDASPAPTEPAPTEPAVRVGTPVESATGNGVGVAPRDASERMVFGTWAGLTG
AAAAGVTSPLPKIDVDKATEIAERLTERSGVSISVEQVLAAETLEPLADAVREGFETEVE
GNIRVLRPRPEGSEKPAVFMFHPAGGSSVVYQPLMRRLPEDVPVYGVERLEGQLEDRAAA
YVEDVKAYSDGLPVILGGWSFGGALAFEVASQLQDSDVEVATIALLDTVQAAEPSPDTPE
ETRARWERYQAFAKKTYGLDFPVPFELLETAGEDALLGMLGEFLSSTDASEHGISAGVLE
HQRASFVDNRILDKLDFTRWAAVSAPVLLFRAERMHEGAIELEPSYATIDPDGGWSVIVE
ELEIIQLRGDHLAVVDEPEIGTVGAHLTRRIEEIAHKNNLTES

Enzyme Prediction     

No EC number prediction in MGYG000002406_00124.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00833	PKS	0.0	104	523	2	421	polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations. PKSs can be divided into 2 groups, modular type I PKSs consisting of one or more large multifunctional proteins and iterative type II PKSs, complexes of several monofunctional subunits.
COG3321	PksD	0.0	102	1161	3	1049	Acyl transferase domain in polyketide synthase (PKS) enzymes [Secondary metabolites biosynthesis, transport and catabolism].
smart00825	PKS_KS	3.31e-153	105	523	1	296	Beta-ketoacyl synthase. The structure of beta-ketoacyl synthase is similar to that of the thiolase family and also chalcone synthase. The active site of beta-ketoacyl synthase is located between the N and C-terminal domains.
pfam00109	ketoacyl-synt	6.63e-94	105	350	1	249	Beta-ketoacyl synthase, N-terminal domain. The structure of beta-ketoacyl synthase is similar to that of the thiolase family (pfam00108) and also chalcone synthase. The active site of beta-ketoacyl synthase is located between the N and C-terminal domains. The N-terminal domain contains most of the structures involved in dimer formation and also the active site cysteine.
TIGR02813	omega_3_PfaA	1.31e-86	105	914	9	871	polyketide-type polyunsaturated fatty acid synthase PfaA. Members of the seed for this alignment are involved in omega-3 polyunsaturated fatty acid biosynthesis, such as the protein PfaA from the eicosapentaenoic acid biosynthesis operon in Photobacterium profundum strain SS9. PfaA is encoded together with PfaB, PfaC, and PfaD, and the functions of the individual polypeptides have not yet been described. More distant homologs of PfaA, also included with the reach of this model, appear to be involved in polyketide-like biosynthetic mechanisms of polyunsaturated fatty acid biosynthesis, an alternative to the more familiar iterated mechanism of chain extension and desaturation, and in most cases are encoded near genes for homologs of PfaB, PfaC, and/or PfaD.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAZ00088.1	2.72e-117	23	911	1127	2015
BAZ75991.1	2.72e-117	23	911	1127	2015
BAY90071.1	2.68e-114	23	911	1126	2014
BAY30132.1	3.58e-114	23	911	1129	2017
QKX63105.1	4.31e-102	65	988	1323	2248

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BP1_A	1.16e-159	105	982	10	880	Condensingdi-domain (KS-AT) of a mycocerosic acid synthase-like (MAS-like) PKS [Mycolicibacterium smegmatis MC2 155]
2HG4_A	1.18e-151	105	998	41	909	Structureof the ketosynthase-acyltransferase didomain of module 5 from DEBS. [Saccharopolyspora erythraea],2HG4_B Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS. [Saccharopolyspora erythraea],2HG4_C Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS. [Saccharopolyspora erythraea],2HG4_D Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS. [Saccharopolyspora erythraea],2HG4_E Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS. [Saccharopolyspora erythraea],2HG4_F Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS. [Saccharopolyspora erythraea]
2QO3_A	7.99e-151	105	999	8	894	CrystalStructure of [KS3][AT3] didomain from module 3 of 6-deoxyerthronolide B synthase [Saccharopolyspora erythraea],2QO3_B Crystal Structure of [KS3][AT3] didomain from module 3 of 6-deoxyerthronolide B synthase [Saccharopolyspora erythraea]
6C9U_A	4.23e-149	105	999	34	920	Crystalstructure of [KS3][AT3] didomain from module 3 of 6-deoxyerthronolide B synthase in complex with antibody fragment (Fab) [Saccharopolyspora erythraea]
7S6B_A	6.26e-148	98	994	53	937	ChainA, Polyketide synthase [Streptomyces lasalocidi],7S6B_B Chain B, Polyketide synthase [Streptomyces lasalocidi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I6X8D2	0.0	1	1594	18	1722	Polyketide synthase Pks13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pks13 PE=1 SV=1
P9WQE7	4.59e-198	6	1014	11	1002	Phenolphthiocerol/phthiocerol polyketide synthase subunit A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ppsA PE=1 SV=1
P9WQE6	4.59e-198	6	1014	11	1002	Phenolphthiocerol/phthiocerol polyketide synthase subunit A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=ppsA PE=3 SV=1
Q7TXM0	3.21e-196	6	1014	11	1002	Phenolphthiocerol/phthiocerol polyketide synthase subunit A OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=ppsA PE=1 SV=1
Q7TXL7	2.00e-170	70	1009	4	922	Phenolphthiocerol/phthiocerol polyketide synthase subunit C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=ppsD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002406_00124.