CAZyme Information: MGYG000002406_02076

Basic Information

• Species: Corynebacterium pacaense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium pacaense
• CAZyme ID: MGYG000002406_02076
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242	MGYG000002406_13|CGC5	25090.9	4.0565

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002406	3028764	Isolate	not provided	not provided

• Gene Location: Start: 699102; End: 699830 Strand: -

Full Sequence      

MVISFVGWALSFIDGGAPIRQLEPIPDDVPPARGEAVPVVDIHAPGRTSSQLDFWAQPIA
ADISVSAQAVAAYGNAELVAEGTWPGCHISWNTLAGIGHVETRHGTYSGKLFGGSALNAD
GVATPPIIGIPLDGSPGVAEIPDTDGGALDGDPDFDRAVGPMQFIPESWGRFGLDANGDG
VADPNQIDDAALSAAHLLCENGGDLSTPEGWTRAVHSYNMSTKYLLDVRDAAAAFALRQP
AL

Enzyme Prediction     

No EC number prediction in MGYG000002406_02076.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	90	229	7.6e-18	0.6518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2951	MltB	9.06e-40	1	238	32	278	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
cd13399	Slt35-like	1.05e-24	87	234	1	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam13406	SLT_2	6.08e-06	158	202	155	200	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAF54046.1	3.56e-138	1	242	13	254
BAU95356.1	3.72e-138	1	242	34	275
CAK31277.1	6.65e-138	1	242	1	242
ABC11962.1	6.65e-138	1	242	1	242
ABC11963.1	6.65e-138	1	242	1	242

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.932807	0.064020	0.002833	0.000091	0.000061	0.000186

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002406_02076.