CAZyme Information: MGYG000002406_02730

Basic Information

• Species: Corynebacterium pacaense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium pacaense
• CAZyme ID: MGYG000002406_02730
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		45010.41	9.5165

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002406	3028764	Isolate	not provided	not provided

• Gene Location: Start: 1404333; End: 1405541 Strand: -

Full Sequence      

MLDKWVNRADLAESAINERHGARVWGLPRSNLGLVAWPANTKEKLFVRWHYWWQAHYLDC
LVDAANRRTTKARRERIRYTIRGIALRNIKKLTSNKYFDDKAWLALALGRADKVRKVRAP
KSLQALEFNIIGGIDSLTGVLPWRSGETFYNVPSNGPAAIMMARTGRLDQAIAITDWIFD
NLIDDDGLVMDGLRMRMHGPDLVRNIHPYCQGVALGACLEIALKLRERSGVSSTNVDSVR
DADIAEDSMRFISHIRSLVEAVHRRMANRNNVIDWDTGDGDGGLFKGILVRYLADVAVRL
PDDSAANKRTKRLAARMVLDSAESVWAHRLEVDGLPIFATDWTSDARLPQNFGLGSSGLN
EIVSVVRVDERDLSVQLSGWMLMEAAARVAGHENEKTASATT

Enzyme Prediction     

No EC number prediction in MGYG000002406_02730.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	37	352	8.1e-74	0.8212290502793296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	1.58e-161	7	394	1	375	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	8.10e-11	50	327	33	315	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAU97123.1	2.73e-243	1	390	1	390
BAC19412.1	7.82e-243	1	390	1	390
ALC06835.1	1.11e-242	1	401	1	401
QDX79379.1	3.18e-242	1	390	1	390
AMA01178.1	3.18e-242	1	390	1	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	2.69e-21	50	387	87	387	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	5.70e-20	50	387	88	388	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	3.50e-19	50	387	88	388	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002406_02730.