CAZyme Information: MGYG000002407_00686

Basic Information

• Species: Cohnella sp900169535
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Cohnella; Cohnella sp900169535
• CAZyme ID: MGYG000002407_00686
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
546	MGYG000002407_15|CGC1	59461.28	4.1804

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002407	6325359	Isolate	not provided	not provided

• Gene Location: Start: 28947; End: 30587 Strand: -

Full Sequence      

MKKQVRKLGMLALLLGLLLPAASPKAQAINPGGLIVGADVSMLNEVEELGGSFYENGIQK
DPLEILSGNGMNYVRLRLWVDPYDSVGNPYGGGTNDLATTIALAERAKAEGMGILLDLHL
SDFWADPGTQTKPKAWQSLTYAQLKTAVYNYTKGVITAMKAEGVLPEMVQVGNETSSGIL
WDDGKVGGGIDDFTQLGELLSAGISGIDDALGAGEDVEIALHLDHGGDNNLYRWWFDKIE
EQGVDYDIIGLSYYPFWHGTMGELQYNLNDISKRYGKDVMIVETAYGWTLGDGDGLGNSF
YTTEESVGGYPASAAGQMAYIRDLAEIVRDVPNGRGRGIFWWEPAWLPVEGANWGTEAGK
LYNNDTGLLSNPWDNQTLFDFDGNALPTLAVFDEGVPANRVVNHDFEQDGWTNSPSGWGV
WAGNPSDYDAIKVEEPGVTGDYKLTHWKATAYEASTYQTITGLANGTYSLTAWILNGGGQ
NEVHLYAKNYGGSELQQDLPVSAAKWVKIRIDNIQVTNGQIEIGVYSDANAGNWINMDNV
KLYKTN

Enzyme Prediction     

No EC number prediction in MGYG000002407_00686.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	35	392	3.2e-135	0.9970760233918129
CBM61	399	542	6.3e-44	0.9858156028368794

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3867	GanB	5.72e-155	31	393	36	392	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	1.32e-149	35	392	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASA20573.1	6.02e-298	1	545	1	544
ACU84283.1	4.10e-254	19	545	30	556
APF33716.1	4.77e-251	14	542	20	545
QCR39949.1	1.93e-250	14	542	20	545
AVM62188.1	1.32e-222	35	542	43	549

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	1.38e-101	31	392	47	391	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	8.09e-88	35	397	25	396	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	6.31e-87	35	397	25	396	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1HJS_A	1.13e-56	37	392	6	329	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1HJQ_A	2.45e-53	46	392	14	329	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	4.53e-97	35	396	7	350	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
Q65CX5	9.30e-87	35	397	50	421	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
O07013	5.04e-80	25	392	45	417	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
P48841	3.31e-59	36	392	29	365	Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ganB PE=1 SV=1
P83692	6.17e-56	37	392	6	329	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000246	0.999019	0.000210	0.000172	0.000163	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002407_00686.