CAZyme Information: MGYG000002407_02223

Basic Information

• Species: Cohnella sp900169535
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Cohnella; Cohnella sp900169535
• CAZyme ID: MGYG000002407_02223
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000002407_18|CGC6	41416.89	4.9137

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002407	6325359	Isolate	not provided	not provided

• Gene Location: Start: 333646; End: 334785 Strand: -

Full Sequence      

MSHERDRNPAFHLAETAARRSFVVAADGSGDFASVQAAVDAIPPDFPERVTIFIRQGEYR
EKVFIDRRKVSLIGEGADRTAIRWDDYALKTFPDGEPYNTFNTYTLFAGADDFIAEDLSI
VNGAGRGEDVGQAVALYADGDRAVFRRCRLIGWQDTLFTGPLPPSPVERATFGGPREGAP
RRPSRQYYEDCYIEGDVDFIFGSATAVFNRCELFSKARRESPEDGEDRVHGWIAAPSTPE
DAAFGYLFLSCRLTGDAPPRSVYLGRPWRDFASAAFVRCDMGAHIRPEGWHDWDKPGARR
TARFAEYGCAGPGAPGGHGRAGAANGPAPEGRTAAARVDWSRQLTSEEADDMTVDRVLAG
ADGWNPLAAKPGMFEFGGG

Enzyme Prediction     

No EC number prediction in MGYG000002407_02223.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	22	359	1.7e-93	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	1.73e-78	15	307	75	372	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02773	PLN02773	3.96e-66	17	350	2	288	pectinesterase
pfam01095	Pectinesterase	5.70e-65	23	360	3	297	Pectinesterase.
PLN02682	PLN02682	1.00e-59	11	349	58	352	pectinesterase family protein
PLN02432	PLN02432	6.25e-56	24	349	15	277	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANY70879.1	6.56e-143	23	373	2	331
QZN76920.1	5.76e-140	24	367	20	346
QLG37813.1	6.60e-140	19	367	15	346
APO48005.1	7.64e-140	24	370	3	332
QPK93461.1	7.64e-140	24	370	3	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.27e-38	23	314	6	269	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	3.79e-36	23	314	10	273	Pectinmethylesterase from Carrot [Daucus carota]
3UW0_A	1.26e-31	17	314	28	335	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	6.65e-26	24	314	7	311	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1E_A	4.26e-21	30	290	17	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	2.34e-51	17	349	2	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FM79	9.76e-48	16	348	76	362	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q8VYZ3	3.41e-43	30	349	94	366	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
O23038	1.64e-41	27	314	96	356	Probable pectinesterase 8 OS=Arabidopsis thaliana OX=3702 GN=PME8 PE=2 SV=2
Q8LPF3	1.72e-40	24	349	63	342	Probable pectinesterase 68 OS=Arabidopsis thaliana OX=3702 GN=PME68 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002407_02223.