CAZyme Information: MGYG000002407_02353

Basic Information

• Species: Cohnella sp900169535
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Cohnella; Cohnella sp900169535
• CAZyme ID: MGYG000002407_02353
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
596		68210.88	9.2987

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002407	6325359	Isolate	not provided	not provided

• Gene Location: Start: 462091; End: 463881 Strand: -

Full Sequence      

MLGDSSPFGWGGYGASRERNDRRWKRLDFLLIAILTLFAALTSLIDLGNRSAAQTFWKPG
SAGEGFIVDFGDVRKVDRINLYEGPGATGESKIESSADGTNWEPYLTVEHKTNRVFTWKH
EDKSVEARYMRFTTVRTGFRLYEAGFFAKENETPLAIAGITPLESANPDAEGSGDLVFDE
QSEVPYRPDYRNGMYFDEIYHGRTAYEFIEQMEPYENTHPPLGKWLLSWGVEWFGMTPYG
WRFMAAICGTAMVPLFYAVAKGMFGRTRYAFLATLLLVLEGFRLVHSRMANVDIFGVTFT
IAMYYAMYRFGQSAWRGGRIAPSVGWLALSGFFFGCAASVKWNYLYGGAGLAILFAFALY
RRWREHRLQRERGYFKRLMAVLLAAVLFFVVVPVGVYAVSYIPFVKATKADDAVNAKDLW
QFQKNMYHYHEGVKEEHPYSSKWYTWPEMLRPVWYYGGKDLPAGQAQSIAAIGNPLIWWI
GLLAMLASWAIGLARRDKVVLTIAVMYLSFYVPWMVAPRSITFLYHYFPMVPLLILSIVW
MLRWLEDNFAFGRKATALTVGGAAVLFVWFYPVFTGMTISREWMNIALRWLPSWGF

Enzyme Prediction     

No EC number prediction in MGYG000002407_02353.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	190	404	5.6e-54	0.9237668161434978

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	9.56e-24	417	592	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	1.30e-16	196	363	50	231	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	3.17e-16	417	596	499	695	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam13231	PMT_2	6.35e-13	219	363	2	137	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.21e-11	186	363	13	204	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJD84351.1	7.81e-313	5	596	9	598
QMV41067.1	2.20e-311	5	596	15	603
BBI35296.1	4.26e-311	6	596	15	602
QTH40239.1	1.91e-306	5	596	9	598
AYQ71252.1	1.62e-298	5	596	40	628

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	2.81e-35	196	594	67	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	2.77e-31	196	594	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	2.77e-31	196	594	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	4.43e-29	170	594	56	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
29	48
238	260
289	308
315	337
342	359
380	402
470	492
499	518
523	545
557	579