CAZyme Information: MGYG000002407_03470

Basic Information

• Species: Cohnella sp900169535
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Cohnella; Cohnella sp900169535
• CAZyme ID: MGYG000002407_03470
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000002407_19|CGC9	42442.17	7.5003

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002407	6325359	Isolate	not provided	not provided

• Gene Location: Start: 807451; End: 808572 Strand: +

Full Sequence      

MNRAELREKVAEWTDAYAGRIYRAGRKPPYADTWNYENGTMLHAIYRLYRLTGDERHFGL
VREQVDRYVTEDGAIRTYERTDYNLDQINMGRLLFPLYERTGREKYAKAIRLLALQLEKQ
PRTTEGGYWHKRIYPRQMWLDGLYMAGPFRCMLAAAFGSGRPEEFDDIAIQFELMERHAR
DPKTGLLYHGWDESREQAWADRITGCSPHFWSRSIGWYMMALADSLERFPAGHAGKSRLA
AILERLVSAVTVYQDAETGMWHQITDAGGREGNYAETSGTAMFVYAILKGIRLGVVPSVF
EGTAERGFAGLLRHAARADADGTFRLCRINRVAGLGGHPYRDGSFAYYVGEPVVCDDPKG
VAPFLLAAMELAF

Enzyme Prediction     

No EC number prediction in MGYG000002407_03470.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	29	371	2e-111	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.46e-108	7	372	13	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.37e-98	34	370	27	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG1331	YyaL	0.007	20	128	393	511	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKS56688.1	9.03e-133	32	371	27	364
QYR22869.1	4.32e-132	14	371	11	367
QZN75834.1	4.20e-131	32	371	27	364
APO47288.1	4.65e-131	32	371	27	364
QOS80683.1	6.37e-131	33	371	28	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	7.48e-114	32	370	21	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.50e-89	13	371	16	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	6.24e-89	13	371	6	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4XUV_A	2.94e-21	34	372	47	369	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	6.52e-14	35	370	81	409	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	8.22e-89	13	371	16	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	7.93e-43	159	370	13	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	7.93e-43	159	370	13	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002407_03470.