CAZyme Information: MGYG000002407_04550

Basic Information

• Species: Cohnella sp900169535
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Cohnella; Cohnella sp900169535
• CAZyme ID: MGYG000002407_04550
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512	MGYG000002407_19|CGC25	58282.3	4.9204

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002407	6325359	Isolate	not provided	not provided

• Gene Location: Start: 1963360; End: 1964898 Strand: -

Full Sequence      

MTITTLERKPGEFWWGGVINEGHLMPFGSRPHSRDLRLTDDNQASPLLLSNRGRYIWSEE
PFAFSFNENTLTIDHKQDIRIEDGHETLQGAYRHASHAHFPPSGITPDELAFVAPQYCTW
VEMFYEPTQEKLLDYARSILRNGFPPGVIIIDDNWMQDYGTWDFDKHRFPDPAGMIDALH
ELGFKIMLWVCPYVSPDSIKFRQLRDLGLLMKHADGTPVLRRWWNGYSAVVDYTSTEGSA
WFKQQLDRLIERYGVDGFKLDAGEPLLPDLTNDVAEDVAWSRPVRPMEDCECYARLGIGY
ALSELRMCWKLGGQPLIQRQRDKTHTWDATGLGGLIPNAIAQGLLGYAFNCPDMVGGGMD
GDINSPDFRFDSELFIRYVQCSALFPVMQFSMAPWRVLTGDELSWCMDAVRIRTELGPLL
FELANQAAKDGLPILRSLEFVFPHQGFHSVQDQFMVGESILVAPVLDKGQTTRTIQFPEG
RWQGDDGSVVEGPIRVEVKAPLSRLPWFKKIQ

Enzyme Prediction     

No EC number prediction in MGYG000002407_04550.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	119	509	2e-81	0.9086651053864169

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	5.54e-161	115	482	3	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam01055	Glyco_hydro_31	1.18e-60	116	506	33	433	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
COG1501	YicI	8.48e-58	118	510	268	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06597	GH31_transferase_CtsY	7.10e-35	120	390	14	287	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd06593	GH31_xylosidase_YicI	2.52e-31	123	269	18	165	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYQ73974.1	6.24e-295	6	510	8	512
QHW32726.1	3.48e-287	1	511	1	511
QGQ98782.1	2.62e-236	2	510	3	510
AZN40999.1	3.60e-217	7	509	8	514
QHT59803.1	5.45e-217	12	510	14	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F7U_A	3.63e-26	168	510	435	797	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]
6JR6_A	5.50e-26	129	510	280	683	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]
5F7S_A	8.63e-26	128	511	306	729	Cycloalternan-degradingenzyme from Trueperella pyogenes [Trueperella pyogenes],5F7S_B Cycloalternan-degrading enzyme from Trueperella pyogenes [Trueperella pyogenes],5I0E_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with isomaltose [Trueperella pyogenes],5I0F_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with covalent intermediate [Trueperella pyogenes]
6JR8_A	5.53e-25	129	510	280	683	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101],6JR8_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, mutant D412A complexed with isomaltotriose [Flavobacterium johnsoniae UW101]
5I0G_B	6.52e-25	128	511	306	729	Cycloalternan-degradingenzyme from Trueperella pyogenes in complex with cycloalternan [Trueperella pyogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6NSJ0	3.92e-61	99	491	300	691	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
Q69ZQ1	3.82e-59	99	491	299	693	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
Q9F234	6.61e-27	128	510	273	669	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
P19965	4.36e-26	178	486	345	652	SITS-binding protein OS=Tetronarce californica OX=7787 PE=1 SV=2
P96793	1.17e-24	61	493	196	649	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002407_04550.