CAZyme Information: MGYG000002408_00093

Basic Information

• Species: Bacillus_BD tuaregi
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Bacillus_BD; Bacillus_BD tuaregi
• CAZyme ID: MGYG000002408_00093
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430	MGYG000002408_4|CGC3	49361.77	9.5273

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002408	4862251	Isolate	not provided	not provided

• Gene Location: Start: 53151; End: 54443 Strand: -

Full Sequence      

MKRNVWIWNHYATNMFNDQAGRHFWFAENLNKKGYNPTIFCASTIHNSNETMDTGNFKYI
SKKVNGIPFVFVKTPFYKGNGKQRIKNMIAFYKNLFLVSKKYASVHGKPDVILASSVHPL
TLIAGIKIAKKFKIPCICEVRDLWPESIVAYGALKRNSIIAKVLYLGEKWIYKNADSVIM
TWEGGRKYIMDQRWDKQIDLEKIKHISNGVVIDAFDQNSEEYKIHDPDLDNKDFKNIVYA
GSIRKVNNIGMLLDAAKLIQNQGRKDIRFLIYGSGDESEMLKTRCNEEKINNVIFKGRVE
KKYVPSILKKSYINILHNSSTSLDKYGQSQNKFFEYLAAGKCIVQTYTTGFSICEKYNCG
ISAPVQNAEEIAKAIITASSDERNNILMGKNARETAYLFDFNRLTDKLIEIVENMDESEE
QLNELVQKSS

Enzyme Prediction     

No EC number prediction in MGYG000002408_00093.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	5.33e-78	4	409	1	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
COG0438	RfaB	1.89e-25	84	415	59	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	1.96e-23	20	413	16	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03817	GT4_UGDG-like	2.38e-19	26	412	23	372	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
pfam13692	Glyco_trans_1_4	7.06e-15	235	381	2	138	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFT90858.1	1.45e-249	1	430	1	430
AJD92259.1	3.78e-245	1	430	1	430
AKL93657.1	2.01e-215	1	414	1	413
QSX05280.1	2.33e-214	1	415	1	414
QZZ03274.1	7.81e-170	3	413	2	412

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002408_00093.