CAZyme Information: MGYG000002408_00956

Basic Information

• Species: Bacillus_BD tuaregi
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Bacillus_BD; Bacillus_BD tuaregi
• CAZyme ID: MGYG000002408_00956
• CAZy Family: GH18
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1101		126015.37	6.7559

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002408	4862251	Isolate	not provided	not provided

• Gene Location: Start: 476847; End: 480152 Strand: -

Full Sequence      

MKKDEKGPKKFIFFEKTGRRWKYSKLSFSLISLVAIIFLFFIVKGLLDRPNLAELEINNS
TIRPINSPVSHLVTLDGTLNPLETISITGQETKPKIFTFYQSENHSNRENQVSLKENIDT
IDVLIPDWFYFNKDGNIIDNAEAKIDHLAREHGVQIIPSITLDENSTADDVHNWLSNPQT
QDQMIQNLISTMTTKDYQGVHLNFEDVYWEDKDFYNQFVTKLYQSFHQSGLLLTLFVRLG
DDTYDTQLLSDVSDHLIVKAFDQHIEQGEPGPLASFQWTQELINQYHGAKEKLVLCLANY
GYDWNVTTGEPATPHHFSTLMEMVNRENLQIQWNQDFFTPYVRYMEQEEEHMIWLLDAAT
FYNQMKIAQTNQISSIGVWNIGSEDPTIWRLFSTNHANPKDLETIPNRAATATEGSGDFL
QVTTVESEGKRSFELNNNLIKKEKYIKYPTPYLLKQYGVDEKKVAISFDDGPNPKYTGKI
LEILKKHDVKAAFFLIGQNAAMYPELTNRIYKEGHEIGSHTFTHTDVMTISEKQLKFELN
STQRVIQGITGHSINMFRPPYLSINDGPNELPSEEVMERILKIQDLGYTVVSSTIDPKDW
SGISAEEIVKEVTAKVQNGHTILLHDSGGDRSATIKALPKIIEWLKANDYSIVPASELVG
MERSAVMPAVQKTEESMKPFYLYGSSFQAALIKSIKFFLYLLIIVGLFRLTILLFFSLKQ
KRKSKHRRFNDSYQPFVSVLIAAYNEDKVIGKTIHSIMKSRYPRFELIIVDDGSTDQTAS
IVETECSKYSNVRLLRKENGGKASALNLGFQNASADIIVTLDADTVIAEDTLTIIVRHFV
DPIVGAVAGNVKIGNRKNLLTWWQHIEYVTGFNLEKRAFDELDSITVVPGAIGAWRKSAM
MEVHLFEEDTLAEDTDATMKLLRKGYRIKSEVNAIAYTEAPEDLKSFIKQRYRWTFGILQ
CIWKHREALFAKKNKKLGYIALPNMIFQYVLLATAPVADIILILALTNGHMFVAYFYLAF
LIVDTLIAAYAFSLEKEKKKPLFSLFIQRIIYRQFFTYVVWKSVLFAIKGQLLGWNKLQR
TGSVLQSEFEENRKKKANYGA

Enzyme Prediction     

No EC number prediction in MGYG000002408_00956.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	735	957	1.8e-36	0.9956521739130435
CE4	459	577	6.1e-31	0.823076923076923
GH18	97	383	4.8e-29	0.9222972972972973

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10962	CE4_GT2-like	7.44e-82	462	660	1	196	Catalytic NodB homology domain of uncharacterized bacterial glycosyl transferase, group 2-like family proteins. This family includes many uncharacterized bacterial proteins containing an N-terminal GH18 (glycosyl hydrolase, family 18) domain, a middle NodB-like homology domain, and a C-terminal GT2-like (glycosyl transferase group 2) domain. Although their biological function is unknown, members in this family contain a middle NodB homology domain that is similar to the catalytic domain of Streptococcus pneumoniae polysaccharide deacetylase PgdA (SpPgdA), an extracellular metal-dependent polysaccharide deacetylase with de-N-acetylase activity toward a hexamer of chitooligosaccharide N-acetylglucosamine, but not shorter chitooligosaccharides or a synthetic peptidoglycan tetrasaccharide. Like SpPgdA, this family is a member of the carbohydrate esterase 4 (CE4) superfamily. The presence of three domains suggests that members of this family may be multifunctional.
COG1215	BcsA	9.56e-64	697	1084	16	428	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd10917	CE4_NodB_like_6s_7s	1.29e-63	462	646	1	171	Catalytic NodB homology domain of rhizobial NodB-like proteins. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes many rhizobial NodB chitooligosaccharide N-deacetylase (EC 3.5.1.-)-like proteins, mainly from bacteria and eukaryotes, such as chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan. All members of this family contain a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold with 6- or 7 strands. Their catalytic activity is dependent on the presence of a divalent cation, preferably cobalt or zinc, and they employ a conserved His-His-Asp zinc-binding triad closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. Several family members show diversity both in metal ion specificities and in the residues that coordinate the metal.
cd06423	CESA_like	1.36e-63	739	914	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd10954	CE4_CtAXE_like	2.04e-55	462	658	1	180	Catalytic NodB homology domain of Clostridium thermocellum acetylxylan esterase and its bacterial homologs. This family is represented by Clostridium thermocellum acetylxylan esterase (CtAXE, EC 3.1.1.72), a member of the carbohydrate esterase 4 (CE4) superfamily. CtAXE deacetylates O-acetylated xylan, a key component of plant cell walls. It shows no detectable activity on generic esterase substrates including para-nitrophenyl acetate. It is specific for sugar-based substrates and will precipitate acetylxylan, as a consequence of deacetylation. CtAXE is a monomeric protein containing a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold as other CE4 esterases. However, due to differences in the topography of the substrate-binding groove, the chemistry of the active center, and metal ion coordination, CtAXE has different metal ion preference and lacks activity on N-acetyl substrates. It is significantly activated by Co2+. Moreover, CtAXE displays distinctly different ligand coordination to the metal ion, utilizing an aspartate, a histidine, and four water molecules, as opposed to the conserved His-His-Asp zinc-binding triad of other CE4 esterases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKO95015.1	0.0	11	1084	13	1084
AND42782.1	3.25e-313	1	1094	3	1106
AIE58921.1	7.14e-313	2	1094	6	1127
BAU27076.1	2.71e-312	9	1085	42	1137
QOK29280.1	4.91e-311	1	1094	126	1229

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FBW_A	2.37e-35	462	659	117	300	ChainA, Predicted xylanase/chitin deacetylase [Caldanaerobacter subterraneus subsp. tengcongensis MB4]
5O6Y_A	4.16e-34	460	646	19	195	Crystalstructure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579]
5O6Y_B	4.90e-33	460	646	19	195	Crystalstructure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579],5O6Y_C Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579],5O6Y_D Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase in complex with 4-naphthalen-1-yl-~{N}-oxidanyl-benzamide [Bacillus cereus ATCC 14579]
4L1G_A	2.31e-32	460	646	71	247	Crystalstructure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579],4L1G_B Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579],4L1G_C Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579],4L1G_D Crystal structure of the Bc1960 peptidoglycan N-acetylglucosamine deacetylase from Bacillus cereus [Bacillus cereus ATCC 14579]
2C1G_A	9.51e-32	461	665	235	422	Structureof Streptococcus pneumoniae peptidoglycan deacetylase (SpPgdA) [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9RQP9	2.60e-35	737	957	49	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q5HCN1	2.60e-35	737	957	49	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6GDD8	2.60e-35	737	957	49	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	2.60e-35	737	957	49	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q99QX3	2.60e-35	737	957	49	270	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43
697	718
980	1002
1012	1034
1055	1074