CAZyme Information: MGYG000002408_01652

Basic Information

• Species: Bacillus_BD tuaregi
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; DSM-18226; Bacillus_BD; Bacillus_BD tuaregi
• CAZyme ID: MGYG000002408_01652
• CAZy Family: GT2
• CAZyme Description: Acetyl-coenzyme A synthetase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572		64829.9	4.8015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002408	4862251	Isolate	not provided	not provided

• Gene Location: Start: 1229591; End: 1231309 Strand: -

Full Sequence      

MANTLKEQIEMIDTTANLQNYEKAVQEMDWKKIEQNFTWSKTGKVNMVYEAIDRHVDEGR
GDKKAFIYCDTNREEEYTFSDLKALSCQFANGLRAKGIEKGDRVFIFMPRSPELYISMLG
IIRIGAIAGPMFEAFMEEAVKDRLLDSGAKAVVTTPELLNRIPVSELPDLQYVILVGADE
AKEEHQLLFTDLMQSSNDYTIEWVDREDGMLLIYTSGSTGKPKGVLQVHDAMIHQYLAGK
WVYDLKEDDIYWCTADPGWVTGTSAGMWSPWLNGVTNVLRGGRFDANEWFETLEKYKVTV
WFSAPTALRLLMGNTDELPKKFDLSSLRHMLSAGEPLNPEVIRWGLETLNLRIHDNWWMT
ETGSAICANFRSNPIRPGSMGKPLPGIEVSIIDDNGHELPANHMGNLAIKPKWPAMVRTI
WNNPERYEQYFLNGWFVTGDSAYKDPDGYFWFEGRVDDVINTSGERVGPFEVESKLVEHP
AVAEAGVIGVPDPVRGEVIKAFITLRSGYTESEELLLEIRNFVKTKLAAHAAPRLFEVRD
TMPKTRSGKIMRRVLKAWELGLPTGDLSTMED

Enzyme Prediction     

No EC number prediction in MGYG000002408_01652.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05966	ACS	0.0	28	572	35	608	Acetyl-CoA synthetase (also known as acetate-CoA ligase and acetyl-activating enzyme). Acetyl-CoA synthetase (ACS, EC 6.2.1.1, acetate#CoA ligase or acetate:CoA ligase (AMP-forming)) catalyzes the formation of acetyl-CoA from acetate, CoA, and ATP. Synthesis of acetyl-CoA is carried out in a two-step reaction. In the first step, the enzyme catalyzes the synthesis of acetyl-AMP intermediate from acetate and ATP. In the second step, acetyl-AMP reacts with CoA to produce acetyl-CoA. This enzyme is widely present in all living organisms. The activity of this enzyme is crucial for maintaining the required levels of acetyl-CoA, a key intermediate in many important biosynthetic and catabolic processes. Acetyl-CoA is used in the biosynthesis of glucose, fatty acids, and cholesterol. It can also be used in the production of energy in the citric acid cycle. Eukaryotes typically have two isoforms of acetyl-CoA synthetase, a cytosolic form involved in biosynthetic processes and a mitochondrial form primarily involved in energy generation.
PRK00174	PRK00174	0.0	26	572	39	622	acetyl-CoA synthetase; Provisional
cd05972	MACS_like	0.0	77	557	1	428	Medium-chain acyl-CoA synthetase (MACS or ACSM). MACS catalyzes the two-step activation of medium chain fatty acids (containing 4-12 carbons). The carboxylate substrate first reacts with ATP to form an acyl-adenylate intermediate, which then reacts with CoA to produce an acyl-CoA ester. The acyl-CoA is a key intermediate in many important biosynthetic and catabolic processes.
PRK04319	PRK04319	0.0	17	572	14	570	acetyl-CoA synthetase; Provisional
COG0365	Acs	0.0	38	569	1	528	Acyl-coenzyme A synthetase/AMP-(fatty) acid ligase [Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE6201330.1	2.19e-111	28	572	619	1202
CAE6201338.1	2.56e-111	28	572	630	1213
CAE6256584.1	1.99e-30	75	555	1581	2055
BAZ00088.1	1.56e-28	74	557	2729	3207
BAZ75991.1	1.56e-28	74	557	2729	3207

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P2B_A	4.71e-120	39	572	69	634	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2B_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P2M_A	1.86e-119	39	572	69	634	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2M_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P2F_A	1.86e-119	39	572	69	634	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2F_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
5JRH_A	2.32e-119	39	572	69	634	Crystalstructure of Salmonella enterica acetyl-CoA synthetase (Acs) in complex with cAMP and Coenzyme A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5JRH_B Crystal structure of Salmonella enterica acetyl-CoA synthetase (Acs) in complex with cAMP and Coenzyme A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
2P2Q_A	2.62e-119	39	572	69	634	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2Q_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39062	7.57e-266	12	572	9	572	Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) OX=224308 GN=acsA PE=1 SV=1
A0B8F1	2.93e-133	39	570	83	646	Acetyl-coenzyme A synthetase OS=Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) OX=349307 GN=acsA PE=1 SV=1
P27095	1.33e-131	37	570	91	659	Acetyl-coenzyme A synthetase OS=Methanothrix soehngenii OX=2223 GN=acsA PE=1 SV=1
O93730	2.50e-131	14	572	40	649	Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / DSM 7523 / JCM 9630 / CIP 104966 / NBRC 100827 / IM2) OX=178306 GN=acsA PE=3 SV=2
A4WJG1	3.53e-131	17	572	43	649	Acetyl-coenzyme A synthetase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321 / PZ6) OX=340102 GN=acsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002408_01652.