CAZyme Information: MGYG000002411_01772

Basic Information

• Species: Christensenella sp001678845
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Christensenellaceae; Christensenella; Christensenella sp001678845
• CAZyme ID: MGYG000002411_01772
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
198	MGYG000002411_5|CGC2	22328.6	4.6739

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002411	3026585	Isolate	China	Asia

• Gene Location: Start: 218520; End: 219116 Strand: +

Full Sequence      

MGRMDYKRRKGVNKAVVAVICIAVAAVVVLACIFVLMPQIERNQYKLEYADLIEKYSDRY
GLDPYFVAAIIHTESGFDPEAVSGAGAMGLMQVVPETGEWIAGKLGLENFTANDLLNPET
NIEMGCWYLQFLQERFDTLPVIMAAYNAGHNKVKEWLADPRYSDDGTNLTNIPYGETDNY
VKKVTKAYEKYKELYELG

Enzyme Prediction     

No EC number prediction in MGYG000002411_01772.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	62	192	1.2e-33	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	4.23e-80	47	190	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.20e-55	49	194	6	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	2.70e-38	64	189	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.85e-38	45	195	135	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	2.28e-35	51	189	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYH39946.1	3.67e-120	1	198	1	197
QWT54455.1	4.36e-53	20	198	29	209
APH13298.1	1.02e-52	45	195	28	179
ACL76418.1	1.11e-52	7	196	6	192
AVQ45663.1	1.66e-51	45	195	28	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.85e-19	41	195	400	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.85e-19	41	195	404	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.86e-19	41	195	414	573	Lytictransglycosylase in action [Neisseria meningitidis]
6FPN_B	1.86e-19	41	195	410	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O29_A	1.87e-19	41	195	420	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	3.29e-23	39	188	52	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P0AGC4	1.43e-18	43	191	474	624	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.43e-18	43	191	474	624	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	6.61e-18	43	191	474	624	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O64046	1.67e-16	38	190	1411	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999867	0.000056	0.000002	0.000000	0.000000	0.000094

TMHMM  Annotations     

start	end
15	37