CAZyme Information: MGYG000002414_00376

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_00376
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000002414_1|CGC7	41924.73	5.1571

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 413468; End: 414583 Strand: +

Full Sequence      

MNNIRISKVEIIEKLNRVTDKLLKLERPENEAELQNLGEDAGRRGYFARDFGMEEWDWPQ
GVGLYGLQKLEQHFKDERYQEYAKLWMSKQLGKGLPSRNINTTAPLLSLMELKEAEELSL
EWVQWLMHGLPRTEESGYQHVTTGASKDEVTLNDNEIWIDTLFMAILFTAKMGVKYDNSA
WRQASLYQLLLHIKYLYDKKKGLFFHGWHFGGRHNFSEAFWCRGNSWFTLGLPEYLELMG
PYLDSGVFEYLQQILNAQATALLACQSGDGLWHTLLDDSSSYTETSGSAAIAAGILHSVR
RGVLPESYADPALKAIRAVLDRIDDEGTVLGVSGGTPIGAAKEDYKQIIIAPMAYGQAMV
LVALGEALHYC

Enzyme Prediction     

No EC number prediction in MGYG000002414_00376.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	54	367	8.1e-86	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.49e-86	44	368	21	350	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.88e-80	50	368	20	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV31473.1	1.33e-277	1	371	1	371
AIQ72107.1	2.37e-271	1	371	1	371
ASA26546.1	4.14e-240	1	370	1	370
QSF47568.1	5.29e-236	3	371	12	380
AIQ44664.1	1.34e-230	8	371	12	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	9.12e-75	52	369	62	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	9.86e-74	52	369	61	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	8.91e-66	52	366	43	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	1.99e-14	155	369	197	412	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	3.75e-13	56	320	39	312	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	3.36e-42	47	368	23	336	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	2.05e-12	56	320	39	312	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002414_00376.