CAZyme Information: MGYG000002414_00420

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_00420
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750	MGYG000002414_1|CGC8	84742.87	4.8007

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 463715; End: 465967 Strand: +

Full Sequence      

MKTQAFDLQNVRIDSGPLLHAMELNTDYLLKLEADRLLSRFREYAGLEPKAAHYEGWESQ
GISGHTLGHYISGCALMYASTGNEELLQRVNYVVDELEQCQDAHGNGFISGIPRGRELFE
EVKAGDIRSQGFDLNGGWVPLYTMHKLFAGLRDAYRLAGNQKALVIETKLGLWLEDIFAG
LSKDQIQEVLRCEFGGMNEALTDLAEDSGDDRFLALAESFYHGEVLNDLAVEKDTLAGRH
ANTQIPKIIGAARQYEVTGQEHYAGISRFFWDRVVNHHSYVIGGNSYNEHFGEPDKLNDR
LGEGSCETCNTYNMLKLTKHMFQWDAYAAYADYYERAMYNHILASQEPVDGRVCYFVSLE
MGGHKSFNSQFESFTCCVGSGMESHSMYGSAIYFHSADELYVNQYVPSTVAWKEQGISLQ
QETKYPAEGQGVLRISAAQPTKFTLKLRHPYWAEQGMSVSVNGEDVQVNVGKSNYFALDR
EWQDGDVVEYDIPMSVRIETMPDNPNRVAFLYGPLVLAGDFGPINAEANSDRALASVLIG
DRDTLTDNLIQSNVSKNVFRMKGLGYTGDHELRPFYPMHDHRYSVYWDLFTPEEWKLAEA
EYREAVENNLLLEQLTVDSVQPAEMQPERDHNFTGEFVGLGKIHNRKYRDSWINGWFSFT
MEVLPDEQVDLVVTYLKSNDTSLAFDILADGKQLGVGTLESEEMNKLETIRYELPQTITS
GKSAVTIKFASHEGHKVGQVARLRIVKRNS

Enzyme Prediction     

No EC number prediction in MGYG000002414_00420.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	11	518	3.6e-213	0.9960238568588469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	10	518	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	7.63e-142	8	523	9	506	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	2.92e-05	535	587	29	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV31512.1	0.0	1	750	1	750
AIQ72149.1	0.0	1	750	1	750
AIQ21730.1	0.0	1	750	1	750
AIQ33512.1	0.0	1	750	1	750
AFC29386.1	0.0	1	748	1	748

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.13e-177	6	728	28	785	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	2.06e-171	6	728	28	785	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	4.45e-23	138	516	132	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.26e-21	138	516	132	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002414_00420.