CAZyme Information: MGYG000002414_01127

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_01127
• CAZy Family: GH87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2287		246258.82	4.6333

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 1286785; End: 1293648 Strand: +

Full Sequence      

MKRIRSAMAGLLALLLIFSSLPVMGTGSGSVGAEGVGGTGAEQIPSGTVLIKNKWKNNFL
YETSAGIVRYGMTNPADASAHWTVETVNGLSRIKNVKTGHYITMAGNNGKEDSLKAAEHQ
GSGSVADQWLIDTSNRNGYMIIRSATVPEGKLVIHEENQLGYAQVSSDINVTFESPQWAF
IDPNAAPVRLESRLRPGQVMYESEGNVLYGKQPVSNEAAQWYLESGTDDGTVMIRNRATG
HYIKQNEVTWAGVFSQEVDLDHVKLSEWVQEHAPGLDGTGFITLRNSGLTEEGSPLWLNP
QFSDDNNVRSNSWPGSASNPSAQWRIVPISELQPVRLATYTDAQVATDFLYESANGELKH
GIIAPDAANISDYLWYIEDYDGNKRIRNAATDHYVSYSEGTAKALQISGSQPSDQWIFND
SDDYDDYQTLQNLESTGIYLSTLGGEQAGAIGDATSLSAQWQLLDPNTPTDGTVPYYRIQ
NGWKSFYWYESVEGLLKYGNMQKDGSDQWLVEKYNGRKLFKNKKTGHYLNTMNMPNGHLQ
VTELPDRNHVEREYIWTGKNVGNNTYVISSVLDKEPNKIPEKYISLQNLTKYAEYGVINP
GWGSPQWRFVPVTEKKQDLFRFQLDAVNGEDQYLKDGPLLTFPAALEELPESKTVTEAVY
ADQDSAHSNESLAPLAVANEDVTVGQATYGPLDLNDDSFVWHLQEIAGSNGSVKIKNKGT
GRYLSLEHIGGAVDEIDPKVSVQTLQTVYDVWASIKWKVDMKASGVTTIMSSWAGHYIYG
APDDNGNPILRISKAADTAEKSSAHFTAEAVEAIAPPLPDYSVRFKNASSGEYLYENEHG
VVLYGQPSADNGFSHWNVTVQEGKQTITNRATGHFLTLNGDYSYLESSSTEPAVDGASAW
EVSLASDYTHYTIRSLFGEYDDELINIANKTGYAERALLLESEGTALWTLEAAPQEFTTP
SGELRNNNTTTPVQNDTNIITIVPKGMTGKVLAEKEGAVLYADASDMAAQSQWLVQEING
RKRIMNVQTQHYLSLNESGQVVLLAAGDTERSQWKLEEKLGYTLLLNANGTGLLTHSTSA
VQLGSATNGTDSELWSFLPIPSDAIYAGGEAFKGERIIRFAVNAQQTGEYDAVIRYKNTT
AAATDLALEVNGLIEGGKVSLGKSASWKTVQVKLQLRAGINTVSLSSDNVDWSKVTLDSL
TVKNSVNKTYRGATVPYISYEAEDAATNGTLIGSSRKYLSMASEASGRQAVALKNTGDYL
EFKLAESANSIVLRYSIPDSPDGAGAEETLTLYVDGVKKQLKLTSKYAWEYGSYPWSNDP
RQGSGHRFFDEIHALIGDAPAGATIRLEKGTGDNAASYVIDLVDMEQVAPELARPDGFIS
VTDFGAAANDEGDDTAAFKAALAEANATGKGVWFPAGTFNVGEGLLDLDTAEIRGAGMWY
TVLNGAKFYGHGGKVGVYDLMIEGGINERDDEAITNAFHGAFGQGSIIQNVWIEHTKAGL
WLTQPMGEKARTNGLYMAGLRIRNLMADGINFAVGTGNSMMEQSDIRYPGDDGIAMWSFT
DGKLTDVNGTERTPSYNNTARFNTVSLPWLADNIVIFGGKDNKVQDNVVKDTVTNGAGIA
VSSRFTAEPFQGTTVVERNTLLRTGSYDSGYGVNLGALRLYAGESDLKGKVLIRNNTALD
STYSGLIAQGDLEGDTLTSIDGVVLTNNVLDGAGTSGIEVTKNLKGSLLVDNMIIRGERM
NLLTNASPDLSIKEQNQGIATAIKPFSIKLADGQSGPVILEQGKSATLKVLDKVGRDITA
QATLNLMSSEIATFTNDSLNGIKAGITDFTVTVGNEKRVYTIEVLSPGGIDPVDPIDPVD
PTSTPSPTSTPSPTNTPEPTSTPGPTDPTGSVNPVQTGTPTVTPAPTPAGNHDAQLKAKA
TAGQAVIEISANGDGTARFSADALRKAAALSPKAVLVIESGGMSYRFPLELVESVLKDAQ
MPAGTLEFNVNSLSGKGLEQLLAKAKQQGFTVQGTPANITLKVTDGKTSVAASGFGTTYV
DRTFMLKEALDAKTGVVLIYDEQTGSFRYVPALFEPVNGMTKVTVKSSIASGVFVAALHP
VTFGDIATHWARNEIEGLASRLILTGQSTDTFAPQKSVSRAEFAAMLIRSLGLVAANTTK
TFSDVSDLSWYAADARAAAALGLIQGYEDGTFRPNAPITREQMAVMAARAMKLLNLEAEG
YGANVATDVFTDASTISSWAKEAVSDLVAKGIMKGQPSGSFAPSGDTSRAEAAVILVRLL
KAAELLN

Enzyme Prediction     

No EC number prediction in MGYG000002414_01127.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	1168	1742	7.4e-173	0.8944723618090452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	4.59e-67	1212	1364	1	155	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
cd04083	CBM35_Lmo2446-like	1.33e-12	1118	1202	39	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
NF033190	inl_like_NEAT_1	1.10e-10	2101	2281	580	753	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.
cd04082	CBM35_pectate_lyase-like	7.05e-10	1118	1202	38	124	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
pfam00395	SLH	3.84e-09	2162	2203	1	42	S-layer homology domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV32140.1	0.0	1	2287	14	2300
ASS68999.2	0.0	1	2280	1	2223
QJC51422.1	0.0	1	2286	1	2213
QJD83813.1	0.0	1	2286	1	2210
QGG55568.1	0.0	11	2286	13	2230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7C7D_A	1.24e-74	1212	1707	54	526	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]
5ZRU_A	2.47e-72	1204	1718	5	528	ChainA, Alpha-1,3-glucanase [Niallia circulans],5ZRU_C Chain C, Alpha-1,3-glucanase [Niallia circulans]
6K0M_A	6.70e-41	1211	1689	13	495	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
6K0P_A	7.05e-40	1211	1689	13	495	Catalyticdomain of GH87 alpha-1,3-glucanase D1045A in complex with nigerose [Paenibacillus glycanilyticus]
6K0S_A	7.05e-40	1211	1689	13	495	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38536	2.38e-31	1926	2281	1527	1856	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P38535	7.91e-29	2101	2281	906	1082	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
C6CRV0	2.63e-27	2102	2281	1282	1460	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P19424	6.39e-20	2103	2280	41	214	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
Q06848	1.03e-14	2124	2281	243	399	Cellulosome-anchoring protein OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=ancA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000282	0.998907	0.000253	0.000192	0.000175	0.000159

TMHMM  Annotations     

start	end
7	29