CAZyme Information: MGYG000002414_01825

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_01825
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	MGYG000002414_1|CGC39	32657.25	4.7058

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 2119397; End: 2120287 Strand: +

Full Sequence      

MLITVSKSVDEGFSSLQEALDSIPQEHKEEVTIRIKPGIYEEKITVKQGTPPVLLLGEDT
NSTIITWSDNAHTLGPDGEPLGTFKSGTLNVFAEHFTAENLTIRNASGPGTGQAVAAFVD
AGHAVFRRVRLLGDQDTLYTGQGKQYYNECYIEGDVDYIFGAATALFERCRLHNKRSRGY
ITAASTPEGAPFGYVFLDCEITSGQGVSEVYLGRPWRPYAHVAFIRTVMDSSIIGEGWHN
WGQPDREETSRYEEYGSSGPGANPEARAAWSRQLIPQEAAEYRVLSVLDGWHPEGY

Enzyme Prediction     

No EC number prediction in MGYG000002414_01825.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	3	289	8.3e-99	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02682	PLN02682	2.58e-90	3	290	71	363	pectinesterase family protein
PLN02773	PLN02773	2.85e-88	2	289	6	297	pectinesterase
PLN02432	PLN02432	8.29e-77	1	290	11	288	putative pectinesterase
COG4677	PemB	5.58e-71	13	291	94	405	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	8.38e-67	3	290	2	297	Pectinesterase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV32761.1	4.81e-224	1	296	1	296
AIQ73419.1	3.12e-220	1	296	1	296
QQZ59060.1	1.48e-218	1	296	1	296
CQR54721.1	1.48e-218	1	296	1	296
AIQ68023.1	1.09e-215	3	296	1	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	8.84e-39	13	290	15	300	ChainA, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	4.70e-38	13	291	44	361	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1GQ8_A	7.00e-38	3	270	9	281	Pectinmethylesterase from Carrot [Daucus carota]
2NSP_A	8.20e-38	5	293	8	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
5C1C_A	3.37e-37	10	267	16	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.66e-67	2	289	6	297	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	1.50e-66	3	290	85	377	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9SIJ9	8.02e-55	1	282	49	320	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q9FM79	8.20e-55	2	282	81	366	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q8LPF3	1.75e-52	2	292	60	355	Probable pectinesterase 68 OS=Arabidopsis thaliana OX=3702 GN=PME68 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002414_01825.