CAZyme Information: MGYG000002414_01869

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_01869
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
703		77944.12	6.6314

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 2164358; End: 2166469 Strand: +

Full Sequence      

MRKLCRNILILSSLLMASLTLTHGTTEAAFIKDGAERQPPIQIANVYKFNFTNQVKTGYQ
SIRYDSNRGAQLYDSSLGYGFVQETNALPAREVHTDSITSDGTGFFITEPYFFAEPKSEK
DNYNNYGMAFRMDAPPGTYNVYVKTSSDAEDGIVSVSGMQTSRLLKSGHWDAAKLVPVNH
TAVAKGKEWTYTYVNGRDHIDIEIEPSKVNTAVGIEEIILEPILPQHRAAGALPNLFILG
DSTVKSYTFDEAPMSGWGQIIGSMFNQHKVSVTNYSMGGRSFKNAYTEGRLNDILLNGSI
GDYVFIQFGHNDESADEFRRYGRGSTEAMYENYLKEVYLPAIQARGMIPVLVTPMSRIKG
NASPGYIYENSFKSRKFVDILKRVADESGVTLIDLNSESLKYYNEIGVEAITSLFMSIEA
GETPGKTNDGSYANGHPSKKVDGTHFKEALAKQFSRMIVTELVEKGATGDSTAASITPYL
KGNVKHAALTGNWGKIFPEITNDTTTGEAAYYRNQIEKLIQLGVMGKDRHGNFNPDTEMT
VAEFTRSISKLMKVERSDLAYYPKGKLSRETMGAILYDVYQIKFANKPKYMTDYNGTAVV
PGDPGYDSNLDPGARGAMYYPLVSWTQLVDTADISPYLISKVKSAYELGLIRSEVGIARG
KMVNGTELEPKAIVTREKAAKALYFMWVLEHEVNAENHVSSLK

Enzyme Prediction     

No EC number prediction in MGYG000002414_01869.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	235	462	1.1e-50	0.9952380952380953

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	6.37e-45	234	462	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
COG2755	TesA	1.63e-11	232	398	7	174	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
cd00229	SGNH_hydrolase	2.51e-07	236	405	1	163	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
pfam13472	Lipase_GDSL_2	3.74e-07	238	397	1	149	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
pfam00657	Lipase_GDSL	1.61e-05	236	396	1	183	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV32802.1	0.0	1	703	1	703
AIQ73458.1	0.0	1	703	1	703
QYR20260.1	0.0	11	703	9	702
QYR22257.1	0.0	7	703	6	704
AEI43152.1	0.0	11	703	9	703

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DEO_A	3.46e-07	235	415	2	189	RHAMNOGALACTURONANACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.55 A RESOLUTION WITH SO4 IN THE ACTIVE SITE [Aspergillus aculeatus],1DEX_A RHAMNOGALACTURONAN ACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.9 A RESOLUTION [Aspergillus aculeatus],1K7C_A Rhamnogalacturonan acetylesterase with seven N-linked carbohydrate residues distributed at two N-glycosylation sites refined at 1.12 A resolution [Aspergillus aculeatus],1PP4_A The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus],1PP4_B The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus]
3C1U_A	3.46e-07	235	415	2	189	ChainA, Rhamnogalacturonan acetylesterase [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31528	9.33e-27	235	466	4	206	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
O31523	3.95e-23	235	466	7	216	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
Q5BAA2	3.99e-10	235	450	19	225	Rhamnogalacturonan acetylesterase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN2528 PE=1 SV=1
Q00017	2.26e-06	235	415	19	206	Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus OX=5053 GN=rha1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000437	0.997797	0.001107	0.000245	0.000194	0.000176

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002414_01869.