CAZyme Information: MGYG000002414_01965

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_01965
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		44486.03	6.508

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 2283026; End: 2284279 Strand: +

Full Sequence      

MNKRIGKLVLCMAISLGGTTALFQNTTQAATAGGVSIVLDGYPLPFPVEPVVMSGTTMVP
FRAISEALGINVEWNQAQKKITATKTDTAGTKVVTLTLGSKDAGVNGAVVKLGVAPQTIR
DTTMIPLSFFGQQFGAGVAWNQSTKTVSITSPKTELYTLGFYALSSYSEISLLPNFDAVA
FGWSGIDKSGQFTTTGTDFKWPQAAGDVTPESIVTNAVAGGTAPYLMVFSGDTASELTKN
LEDKQLQEQTITGIVDLATQKGFQGITLDLEGLGLTGDKAKVQADYNAFVKNLSQKAHAA
GLKLTVILHPLNSSYKGYDYKTLGTLADDLVIMAYDYLQEKKVPEPMSLVDEGIRLALQQ
VSKDKLILGISVYSENESSVNSKVGLAKRYGLKGIAIWRLGLIGQPVWNEMGKSVEL

Enzyme Prediction     

No EC number prediction in MGYG000002414_01965.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	225	374	9.4e-17	0.4391891891891892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	6.96e-39	158	411	4	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
pfam07833	Cu_amine_oxidN1	6.49e-32	55	149	3	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
COG3858	YaaH	2.51e-19	152	408	98	415	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd00598	GH18_chitinase-like	6.18e-12	191	401	33	208	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
cd06545	GH18_3CO4_chitinase	1.15e-10	170	401	2	240	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV32884.1	1.20e-301	1	417	1	417
AIQ73544.1	4.69e-299	1	417	1	417
AIQ23135.1	2.15e-285	1	417	7	423
AIQ34982.1	2.23e-281	1	417	1	417
CQR54861.1	8.53e-230	3	416	2	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CZ8_A	8.98e-12	208	373	67	224	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4S3J_A	3.58e-10	213	417	158	427	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4Q6T_A	1.13e-09	241	381	92	244	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
4S3K_A	4.33e-07	241	373	191	327	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05495	6.13e-11	137	373	78	316	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P0DPJ9	6.22e-10	213	417	157	426	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
O32258	3.39e-08	144	416	21	344	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000362	0.998827	0.000214	0.000233	0.000178	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002414_01965.