CAZyme Information: MGYG000002414_02565

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_02565
• CAZy Family: CBM66
• CAZyme Description: Extracellular exo-alpha-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
179	MGYG000002414_1|CGC58	19872.06	4.4862

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 2925240; End: 2925779 Strand: -

Full Sequence      

MSLLKSIKKNVSVTMCITLLFSLFIVYPASASTFFQDRFEEGDNLWTSTSGNWTIVEDEG
NSVYYQSATKEGRTSAGDPAWSDYTVEADVKVVDFNGSNRTYVAGRYIDGNNFYAASLYN
NNDGMLEIRKKVSGSTTTLSSKPYALQTGVWYNVKLEMSGNTINLYINDTLELSASDSK

Enzyme Prediction     

No EC number prediction in MGYG000002414_02565.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM66	46	178	8.8e-21	0.8258064516129032

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13385	Laminin_G_3	3.73e-05	82	178	17	108	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
smart00282	LamG	0.002	109	176	22	86	Laminin G domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV33414.1	1.19e-125	1	179	1	179
ANY65996.1	6.40e-70	7	178	5	180
ANY66001.1	1.92e-69	7	177	7	178
QYR21238.1	6.01e-56	23	178	1	157
QKS46472.1	1.78e-55	31	178	9	157

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.015730	0.982437	0.001104	0.000261	0.000210	0.000219

TMHMM  Annotations     

start	end
13	35