CAZyme Information: MGYG000002414_02880

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_02880
• CAZy Family: GH87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1166	MGYG000002414_1|CGC61	122421.21	4.7675

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 3239426; End: 3242926 Strand: +

Full Sequence      

MRNKYVVWSLVVTLLISSLYLAAGPFTFVSASGGANLTLGKTVTASGQSQTYSPNNVKDS
NQETYWESSNNAFPQWIQVDLGTETSIDQIVLKLPTGWETRTQTLAVLGSTNGSTFTDIV
GSADYVFNPSAGGNTVKLDFSAISTRYVRLNVTGNTGWPAAQVSEFEIYGASTPIPTPTV
TPTPTATPTPTVTPTATPTPTATPTPTATPTATPTATPTPTVTPTPVTGSNIAVGKSITA
SSNTQSFVAANANDNNTNTYWEGGSNPSSLILDLGSNYNVSSIVLKLNPAAAWGARTQTI
QVLGHNQNTTTFGNLVSAQSYSFNPASGNTVTIPVTATVKRLQLNITANSGAPAGQIAEF
EVYGTPAPNPDLVITGMSWSPTNPVESNAITLNAIVKNIGNASSPATTVNFYLNNELVGS
APVGVLATGASTTASMTLTAGVKPAATYSVSAKVDEDNLVIEQNEANNSYTNPASLIIAP
VSSSDLVGTVTWTPSNPVANNNVAFNVNLKNQGTIASASGSHGISVVLKNSAGSTVQTYN
GSYNGALAAGASVNVAIPGTWTAINGNYTVTSTVEVDANEIAAKQANNVSVSNLVVYAAR
GASMPYSRYDTEDATLGGGATLKSAPTFDQALLASEASGQRYIALPSNGSNLEWTVRQGQ
GGAGVTMRFTMPDSADGMGLNGSLDVYVNGAKVKTVSLTSYYSWQYFSGDMPGDTPSAGR
PLFRFDEVHWKMDTPLQPGDKIRIQKNNGDSLEYGVDFIEIESVPTAIARPANSVSVTDY
GAVANDGQDDLAAFKATVNAAVASGKSIYIPAGTFNLSSMWEIGSASNMINNLTITGAGL
WHTNIQFTNPNAAGGGISLRISGKLDFSNVYMNSNLRSRYGQNAIYKGFMDNFGTNSIIH
DVWVEHFECGMWVGDYAHTPAIYATGLVVENSRIRNNLADGINFSQGTSNSIVRNSSVRN
NGDDGLAVWTSNTNGAPAGVNNTFSYNTIENNWRAAAIAFFGGSGHKADHNYIIDTVGGS
GIRMNTVFPGYHFQNNTGVVFSDTTIINSGTSKDLYGGERGAIDLEASNDAIKNVTFNNI
DIINTQRDAIQFGYGGGFENIVFNNININGTGLDEITTSRFSGPHKGAAIYTYTGNGAAT
FNNLTTSNIAYPNLNYIQSGFNLTIH

Enzyme Prediction     

EC	3.2.1.59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	507	1161	5.8e-190	0.9748743718592965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	5.43e-48	601	761	1	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
pfam07705	CARDB	3.30e-22	370	472	2	101	CARDB. Cell adhesion related domain found in bacteria.
cd00057	FA58C	6.85e-20	30	170	1	143	Substituted updates: Jan 31, 2002
pfam00754	F5_F8_type_C	2.25e-18	42	166	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
smart00231	FA58C	3.67e-11	34	171	1	139	Coagulation factor 5/8 C-terminal domain, discoidin domain. Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV33697.1	0.0	1	1166	1	1166
BAG15879.1	0.0	1	1166	1	1172
AIQ74378.1	0.0	1	1166	1	1184
AIQ23898.1	0.0	1	1166	1	1305
AIQ18252.1	0.0	1	1165	1	1149

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZRU_A	0.0	589	1165	1	577	ChainA, Alpha-1,3-glucanase [Niallia circulans],5ZRU_C Chain C, Alpha-1,3-glucanase [Niallia circulans]
7C7D_A	4.77e-37	601	1147	54	548	Crystalstructure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus],7C7D_B Crystal structure of the catalytic unit of thermostable GH87 alpha-1,3-glucanase from Streptomyces thermodiastaticus strain HF3-3 [Streptomyces thermodiastaticus]
6K0M_A	3.45e-33	590	1092	3	494	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
6K0S_A	3.45e-33	590	1092	3	494	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]
6K0Q_A	6.25e-32	590	1092	3	494	Catalyticdomain of GH87 alpha-1,3-glucanase D1068A in complex with nigerose [Paenibacillus glycanilyticus],6K0U_A Catalytic domain of GH87 alpha-1,3-glucanase D1068A in complex with tetrasaccharides [Paenibacillus glycanilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.549136	0.443412	0.005609	0.000736	0.000375	0.000724

TMHMM  Annotations     

start	end
7	29