CAZyme Information: MGYG000002414_02997

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_02997
• CAZy Family: GH11
• CAZyme Description: Endo-1,4-beta-xylanase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
211		22873.08	9.6318

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 3380980; End: 3381615 Strand: +

Full Sequence      

MFKFNKKIVTVIMAASMSFSLFAATSSAATDYWQNWTDGGGTVNATNGSGGNYSVTWSNT
GNFVVGKGWNTGSPSRTINYNAGVWAPSGNGYLTLYGWTRNSLIEYYVVDSWGTYRPTGT
YKGTVTSDGGTYDIYTTTRTNAPSIDGTATFTQFWSVRQSKRATGSNVAITFANHVNAWK
SYGMNLGSSWSYQVLATEGYQSSGSSNVTVW

Enzyme Prediction     

EC	3.2.1.8	3.1.1.72

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	31	209	1.5e-72	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00457	Glyco_hydro_11	4.27e-89	31	207	3	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ74480.1	7.25e-154	1	211	1	211
AWV33802.1	7.25e-154	1	211	1	211
AIQ23974.1	1.84e-147	1	211	1	211
QSF45644.1	3.71e-147	1	211	1	211
AIQ56232.1	2.06e-144	1	211	1	211

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KV0_A	4.58e-123	29	211	4	186	ChainA, Endo-1,4-beta-xylanase [Paenibacillus xylanivorans],7KV0_B Chain B, Endo-1,4-beta-xylanase [Paenibacillus xylanivorans]
1XXN_A	1.72e-120	28	211	1	185	Crystalstructure of a mesophilic xylanase A from Bacillus subtilis 1A1 [Bacillus subtilis],2DCY_A Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis],2DCY_B Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis],2DCY_C Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis],2DCY_D Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis],2DCY_E Crystal structure of Bacillus subtilis family-11 xylanase [Bacillus subtilis]
1BVV_A	2.45e-120	28	211	1	185	ChainA, ENDO-1,4-BETA-XYLANASE [Niallia circulans],1XNB_A Chain A, XYLANASE [Niallia circulans],2B42_B Crystal structure of the Triticum xylanse inhibitor-I in complex with bacillus subtilis xylanase [Bacillus subtilis],3HD8_B Crystal structure of the Triticum aestivum xylanase inhibitor-IIA in complex with bacillus subtilis xylanase [Bacillus subtilis],3HD8_D Crystal structure of the Triticum aestivum xylanase inhibitor-IIA in complex with bacillus subtilis xylanase [Bacillus subtilis]
2BVV_A	9.97e-120	28	211	1	185	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE) [Niallia circulans]
1HV0_A	9.97e-120	28	211	1	185	ChainA, ENDO-1,4-BETA-XYLANASE [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45705	5.72e-129	3	211	2	210	Endo-1,4-beta-xylanase A OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=3 SV=2
P18429	1.05e-127	1	211	1	213	Endo-1,4-beta-xylanase A OS=Bacillus subtilis (strain 168) OX=224308 GN=xynA PE=1 SV=1
P09850	1.50e-127	1	211	1	213	Endo-1,4-beta-xylanase OS=Niallia circulans OX=1397 GN=xlnA PE=1 SV=1
V9TXH2	1.06e-124	1	211	1	210	Endo-1,4-beta-xylanase Xyn11E OS=Paenibacillus barcinonensis OX=198119 GN=xyn11E PE=1 SV=1
Q0CFS3	6.70e-79	22	211	40	231	Probable endo-1,4-beta-xylanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xlnA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000207	0.999155	0.000160	0.000181	0.000153	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002414_02997.