CAZyme Information: MGYG000002414_03044

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_03044
• CAZy Family: GH136
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1641	MGYG000002414_1|CGC64	175677.05	4.5691

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 3439661; End: 3444586 Strand: +

Full Sequence      

MFKKLVKSLLIMVLIFTAVLPVMGVSAHAEETNADDFSTLPAAEHRSENWLIDSSNPQFF
EGDAARLVRTSTETGYAIYPLTGVQSFTLQAYYFSGSTAVIKFYGSPDADIWTELPAIND
SPTATGSGWYGTVYTPSGALPDGVNYLKIEVSGDLDTWLMQLGHLTLSNVSLAPQTIVDE
LDDIAQLYAHSTNWSLDTSNPAFFGGDHSRAVRTADSAESLVYHLHNLQHFTARMHSFAG
SSGTIKFYGSADASTWTELSAVHEPPQATGDAAWTGTNYTPAQGIPSGIHYLKIELSGDS
APWLMQLGSVTLSNRLPGDGGSSGGDGEYYVNSFAGSDNNDGKTPETAWKTFSVVNQTTF
EAGDRILLKKGGIWNEQLYPKGSGTDEEPITISAYGSGSKPIINGGGMSGAAVYLRNASN
WVIRDLEVTNYASERGTVYREGIMVENANGGTLSNIRIQDNYVHDVSSSFRYPTVSGAEG
GPHAFGGISVYVGGTTGTDKFDGVWIEGNTVERIGRTGIVVWDQRFNGADYATVNVTIRG
NYVKQADSDGILTFGADGAVIEHNIAEEGGNYSEEGEFNGSAAIWPTRGKNNIVQFNESF
NTNKPEGDGQGFNLDIDTMDSVVQYNYSHGNKGGFMLFVDARLTPGVLTGSSNNVVRYNI
SQNDLTHTFNFAGGVTPDTQIYNNTIYIGAGQNTKIIDHEWDDAGNINAPYSFRNNLVYN
LGQGGYNLPGVNGSFDHNLLYGNHPVSEPENTNPITANPLLVAQGTAGIGWNTVDGYKLR
EGSPALGAGAIIADNAGRDYWGNPVSAATPPNIGAYNGPGLDPATLPEAPVDDLRLYFQG
LKIAPHITDGNNGGMSLQLQFTNSSSVDPLRIKKISWTLGKETGQISGSESQLSEIAPNS
GFTYSIPLPGFSEGVKYPLELKVDLEGYEAIHLKQNIDINRMQHQSDTRSPALIDLADGT
PLLNGYNGSDDLSGTAQLRWDEEHIYLTADIRDDVFSHNAAGINIWQNDSIQFSLAPGVP
GDSQSWYEYGISQTPEGPQIYRWLSMKGAATGVLTKGTLSVARDEATKVTSYALALPWSE
ISPIRPAASDILSFSMLVNDNDGAGRKGYIEWGSGIGAAKDASLFRTFQFMNVEGEEETP
LSDNADLSVLRMDGTDISEFDRKKLNYTINVPFSKTAVAVTGTPSDAEAKLTVTGGSELK
VGDNRIDVKVTAANGITTKTYTLNVVRSEEGGGTDTPGNSSGSNNSGNTNESSGGKIVNP
VNIISAGRIRIQGSPGAEGMKIAQLPTGELQKAMKGVQDGALVLELAEEVATASGVAFQV
PIPELKDNVTSLTVKAGAATITLPINTLGENIPEGARQLELSIHFVDASTLPVALKEKWK
THALFRISMTVDGKSKETLSPSAAMKVSFGYKLTPDEVPHQAIVYSVTGEGVVKVVKNSK
YVSGTGKITFTSSDFGLYAAANANIHFSDVDSGSTVILEALASRDLIHGTGGGKFEPARQ
ITRAEFVQLLVSALELQAESSSTFKDVSSNAWYYQAVSTAQALKLVNGRSEGVFAAKEPI
SRQEMAVIFFRALRLSALQSDISGKAATFADEKQIGSYAMDAVEYLRDTGIINGYTDGTF
RPLSLTTRAEAAALIYRVMEL

Enzyme Prediction     

No EC number prediction in MGYG000002414_03044.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH136	328	816	9.2e-124	0.9898167006109979
CBM9	968	1117	8e-18	0.7857142857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	9.82e-51	965	1130	21	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
pfam12733	Cadherin-like	2.73e-13	1160	1227	10	88	Cadherin-like beta sandwich domain. This domain is found in several bacterial, metazoan and chlorophyte algal proteins. A profile-profile comparison recovered the cadherin domain and a comparison of the predicted structure of this domain with the crystal structure of the cadherin showed a congruent seven stranded secondary structure. The domain is widespread in bacteria and seen in the firmicutes, actinobacteria, certain proteobacteria, bacteroides and chlamydiae with an expansion in Clostridium. In contrast, it is limited in its distribution in eukaryotes suggesting that it was derived through lateral transfer from bacteria. In prokaryotes, this domain is widely fused to other domains such as FNIII (Fibronectin Type III), TIG, SLH (S-layer homology), discoidin, cell-wall-binding repeat domain and alpha-amylase-like glycohydrolases. These associations are suggestive of a carbohydrate-binding function for this cadherin-like domain. In animal proteins it is associated with an ATP-grasp domain.
cd09619	CBM9_like_4	3.92e-13	967	1132	31	187	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	4.05e-12	957	1112	3	158	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
NF033190	inl_like_NEAT_1	2.14e-10	1512	1641	570	693	NEAT domain-containing leucine-rich repeat protein. Members of this family have an N-terminal NEAT (near transporter) domain often associated with iron transport, followed by a leucine-rich repeat region with significant sequence similarity to the internalins of Listeria monocytogenes. However, since Bacillus cereus (from which this protein was described, in PMID:16978259) is not considered an intracellular pathogen, and the function may be iron transport rather than internalization, applying the name "internalin" to this family probably would be misleading.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV33845.1	0.0	1	1641	1	1641
AIQ24061.1	0.0	1	1641	1	1640
BBH22310.1	0.0	1	1639	1	1534
QTH41501.1	0.0	1	1131	2	1128
BCA49028.1	4.13e-179	329	852	43	556

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V6M_A	4.47e-59	329	822	11	581	ChainA, Fibronectin type III domain-containing protein [Tyzzerella nexilis]
5GQC_A	5.49e-39	329	815	20	594	Crystalstructure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_B Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_C Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_D Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_E Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_F Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_G Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_H Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQF_A Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, lacto-N-biose complex [Bifidobacterium longum subsp. longum],5GQF_B Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, lacto-N-biose complex [Bifidobacterium longum subsp. longum],5GQG_A Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, galacto-N-biose complex [Bifidobacterium longum subsp. longum],5GQG_B Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, galacto-N-biose complex [Bifidobacterium longum subsp. longum]
7V6I_A	4.97e-38	329	815	16	606	ChainA, Lacto-N-biosidase [Bifidobacterium saguini DSM 23967]
6KQT_A	4.82e-29	329	687	247	638	CrystalStructure of GH136 lacto-N-biosidase from Eubacterium ramulus - native protein [Eubacterium ramulus ATCC 29099]
6KQS_A	1.12e-28	329	687	247	638	CrystalStructure of GH136 lacto-N-biosidase from Eubacterium ramulus - selenomethionine derivative [Eubacterium ramulus ATCC 29099]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C6CRV0	9.47e-36	1311	1641	1125	1461	Endo-1,4-beta-xylanase A OS=Paenibacillus sp. (strain JDR-2) OX=324057 GN=xynA1 PE=1 SV=1
P38536	2.42e-25	1332	1640	1558	1856	Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=amyB PE=3 SV=2
P38535	6.05e-22	1443	1640	887	1082	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1
P19424	2.52e-16	1448	1635	16	210	Endoglucanase OS=Bacillus sp. (strain KSM-635) OX=1415 PE=1 SV=1
P38537	9.67e-15	1432	1640	1	207	Surface-layer 125 kDa protein OS=Lysinibacillus sphaericus OX=1421 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000239	0.999063	0.000204	0.000183	0.000162	0.000141

TMHMM  Annotations     

start	end
5	27