CAZyme Information: MGYG000002414_03455

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_03455
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000002414_1|CGC73	40889.22	4.3476

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 3908139; End: 3909200 Strand: -

Full Sequence      

MTQAKEAIEAVSWREKSEWFQQCLLRNYYNAETGIMNQWYPREYNVAGENFYYWWQAHVI
DILVDGYERSGDPVYSLRIKELSQSLQAYNGETFRHNYYDDMEWTALALLRAYRVTGHEV
YLNAVLDLWEDIKTAWNEQLGGGLAWKKDQLDYKNTPANAPAVILAARLYELFHKQEDLE
WALRIYEWNKTYLMDSTTGFVWDGMNRLGDGQIDYDWEFTYCQGVFLGAGLELYKNTGDA
HYLEDANRTANTCIDRLCDPINLMLPDEGVDDTGLFKGILIRYLVQLCKEVPEVSRIREV
IMANAIQLWEKGLDKQLGLCSSSWEVKPEIPVQLSIQLSGLMLLEGAAALVNE

Enzyme Prediction     

No EC number prediction in MGYG000002414_03455.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	35	329	5.5e-91	0.8519553072625698

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	1.99e-70	13	349	3	369	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	3.05e-42	52	324	33	330	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
pfam05147	LANC_like	0.003	106	284	170	338	Lanthionine synthetase C-like protein. Lanthionines are thioether bridges that are putatively generated by dehydration of Ser and Thr residues followed by addition of cysteine residues within the peptide. This family contains the lanthionine synthetase C-like proteins 1 and 2 which are related to the bacterial lanthionine synthetase components C (LanC). LANCL1 (P40 seven-transmembrane-domain protein) and LANCL2 (testes-specific adriamycin sensitivity protein) are thought to be peptide-modifying enzyme components in eukaryotic cells. Both proteins are produced in large quantities in the brain and testes and may have role in the immune surveillance of these organs. Lanthionines are found in lantibiotics, which are peptide-derived, post-translationally modified antimicrobials produced by several bacterial strains. This region contains seven internal repeats.
cd04792	LanM-like	0.009	59	284	597	825	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ74887.1	1.02e-256	1	353	1	353
AIQ24454.1	5.79e-247	1	353	1	353
AIQ18389.1	2.00e-188	6	353	6	353
QUL53853.1	1.14e-181	10	350	10	350
AIQ68917.1	8.83e-179	2	350	3	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	9.31e-81	9	350	50	389	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	3.02e-79	9	350	51	390	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	2.39e-78	9	350	51	390	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	3.50e-73	13	353	3	343	ChainA, Lin0763 protein [Listeria innocua]
4MU9_A	2.64e-29	27	331	17	345	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002414_03455.