CAZyme Information: MGYG000002414_03456

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_03456
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000002414_1|CGC73	39540.23	4.4016

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 3909213; End: 3910268 Strand: -

Full Sequence      

MNQLETGIWEERANQAQAALDSLFWNEAIKMYNIETPCPNGECNTIFHYWWMAHAVDVLV
DGLQRTRENWYAERLSALHEGLLQRNGGVWPNELYDDMEWMALAWLRAYHATGVEGYKDT
ALLLWNDIQTGWNEHMGGGIAWQKSQLDYKNTPANAPAAILAARLYQAFGEASNLEWALK
IYRWQKEHLVDPATGFVWDGMNRTGDGKIDKDWKYSYNQGIFIGAAVELYRITKEQEYLE
DAHLTFAAAAHELADSQGGVLPDEGNGDAGLFKGILIRYTAEWVKADSAAVDAVDFLRAN
AECLWEQGKSEDTVLFGTDWTSSSAGVIQLSSQLSAIKLLEKMAELTKEQG

Enzyme Prediction     

No EC number prediction in MGYG000002414_03456.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	32	336	1.4e-93	0.8519553072625698

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	7.27e-66	9	346	3	352	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	3.86e-36	48	336	33	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ74888.1	1.70e-263	1	350	1	350
AIQ24455.1	5.54e-244	1	350	1	350
AIQ18388.1	4.02e-194	4	346	6	348
QQZ64307.1	1.46e-193	4	351	3	350
AIQ68916.1	1.34e-192	4	351	6	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	8.11e-83	9	349	3	343	ChainA, Lin0763 protein [Listeria innocua]
6SHD_A	8.66e-78	40	346	79	389	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	2.80e-76	40	346	80	390	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	2.21e-75	40	346	80	390	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4MU9_A	5.00e-30	63	247	87	266	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6FLP9	6.98e-13	48	243	60	274	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
P36091	4.05e-12	121	351	148	398	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
Q75DG6	3.14e-10	91	343	135	386	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
Q5ACZ2	1.77e-08	88	340	122	385	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1
Q05031	1.79e-08	48	343	68	391	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002414_03456.