CAZyme Information: MGYG000002414_04454

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_04454
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
667	MGYG000002414_1|CGC89	76260.9	4.8078

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 5009504; End: 5011507 Strand: -

Full Sequence      

MSLSVSFPVEWFKSAPHTQLTATSSEAFQLITTPEGGGFELQPGQLESAAWCDYGFVNAE
VYHESHDVLVLLFSFYDRDHRVITYHVGILPGVRTKICLPLIHLNGEKLFLPRYPGVMQT
VLRGDAGIDRKHITRFSIATLPSTTSRAVQISGLALSLTEPAFEYEQQPYIDDLGQLKGR
DWPGKTVDAEALTDRLHAERQFVAQVDHSGGDLSRYGGWKALSFAATGYFRTEFDGSRWW
FVDPEGYALFSTGMDCVGPACSMHVTGMEHLIPSLPEREGIYQEAWSQDGEEFSFEIANL
ITAFGAEWRSNWVAMTDFRLQQWGYNTIGNWSNDLFIKESQLPYVYPLVDFPMTEQSIFR
DFPDVFSPEYERNAGSFAEQLLPLREDQRMVGYFMRNEPHWAFVDGLNLTGQMLKSPVRY
ASKKEFIRWLAEKYKTVEQLNKAWDSVFEEFEDLYDVSNVNVTGDNLTSAREVDYNQFNR
IMIRRYVEVPARLCKQTDPNHLNLGMRYAWVGSDEVLEGCEWFDVFSMNCYQFSPDKEQI
AQISGRLNKPVMIGEYHFGAAEGGMLAYGIRAVATQKERGEAYRYYVEQGAAIPQLIGVH
YFQWNDQPVLGRYDGENYQIGVVDVCNRPYEPFVQAARKAHDQMYRVRTGMTAPYNIVPI
EIPKTGF

Enzyme Prediction     

No EC number prediction in MGYG000002414_04454.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	51	645	8e-115	0.9709035222052067

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	0.003	426	500	154	230	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV35106.1	0.0	1	667	1	667
AIQ75804.1	0.0	1	667	1	667
AIQ37144.1	0.0	1	667	1	665
AIQ19711.1	0.0	1	667	1	664
AIQ53931.1	0.0	1	667	1	673

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BQ2_A	6.30e-57	124	650	157	748	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	1.18e-56	124	650	157	748	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
5Z6P_A	8.30e-55	117	648	169	762	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
6XJ9_A	1.37e-53	124	648	176	762	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	7.23e-59	124	648	385	952	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	9.42e-36	128	645	354	913	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002414_04454.