CAZyme Information: MGYG000002414_04845

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_04845
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MGYG000002414_1|CGC97	44720.67	8.5762

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 5420484; End: 5421671 Strand: -

Full Sequence      

MRERMLFLSAQNQSAEDLEGEMRTGSILEILLGKFDIDLLTYGSANQTVSINERTALTVH
NINEDYTTWRPMLRPLHKLRNFSNLSHIDKDMKNTILELCRSNNYKHVFISHVLLGKCID
MVRSLLPEASVITDTYSFANGSGGSAGETGKLSRKNPYNKLNAAWDRRNKRRLMNKTGLL
LATSEWDALAFKSLSFADARKVHVVPHFIKMNEYETFAEPVTKENSIVLHWNMNMKLGID
AARVFFKKTYPMIKEQVPDIKSYIISSEVHPEVMTLIKEDESVIVTGPVNSSTEYIRRSK
AVLVPILEGCEVSRNILESWALKTPVVTSSIMCEKLNCEHNRNILLANTSVEVVGSVLNL
LKNPELGAIIADRAHETLLKNYEMNHVKSKILSLV

Enzyme Prediction     

No EC number prediction in MGYG000002414_04845.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	3.41e-09	168	394	132	364	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.46e-07	158	394	132	373	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam13692	Glyco_trans_1_4	7.01e-07	245	363	19	138	Glycosyl transferases group 1.
cd03792	GT4_trehalose_phosphorylase	0.002	248	382	217	362	trehalose phosphorylase and similar proteins. Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose. The catalyzing activity includes the phosphorolysis of trehalose, which produce alpha-Glc-1-P and glucose, and the subsequent synthesis of trehalose. This family is most closely related to the GT4 family of glycosyltransferases.
cd03811	GT4_GT28_WabH-like	0.003	153	386	115	342	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV35454.1	5.11e-285	1	395	1	395
AIQ76163.1	1.20e-283	1	395	1	395
AIQ25689.1	4.99e-216	1	395	1	394
AIQ37472.1	1.93e-213	1	395	1	394
ASA23773.1	4.86e-134	1	395	1	391

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000018	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002414_04845.