CAZyme Information: MGYG000002414_05154

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_05154
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000002414_1|CGC108	39178.52	5.4135

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 5804321; End: 5805340 Strand: -

Full Sequence      

MRQASDYTEPALKTIFAEDFKIGAAVNPLTIQSQEHLLAYHFNSITAENEMKFESLHPLE
DIYNFKLADQLVAFARKHHMAMRGHTLVWHNQTTDWLFEDKKGGPVSKETLLARLKSHIQ
TVVGRYKEDIYAWDVVNEVIADEGEELLRQSKWLDIVGPEFIGKAFEFAHEADPKALLFY
NDYNESNPLKRDKIYKMVKSLLEQGVPIHGVGLQAHWNLYDPSLDDIRAAIDKYASLGLQ
LQLTELDVSMFRFDDKRIDLKVAPAELLELQAERYEAMFALLKEYRDVISSVTFWGAADD
YTWLDGFPVRGRKNWPFLFDEQHNPKPAYHQLLNAVTKS

Enzyme Prediction     

EC	3.2.1.8	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	12	334	4.8e-115	0.9900990099009901

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	1.54e-132	51	329	1	260	Glycosyl hydrolase family 10.
pfam00331	Glyco_hydro_10	1.06e-129	12	329	1	305	Glycosyl hydrolase family 10.
COG3693	XynA	2.21e-108	23	329	39	334	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV35730.1	8.90e-255	1	339	9	347
AIQ76437.1	2.37e-248	1	338	1	338
AIQ25974.1	1.45e-233	1	339	1	339
AIQ37778.1	2.29e-230	1	338	1	338
AIQ60894.1	2.78e-201	1	333	1	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1N82_A	2.53e-157	10	335	6	331	Thehigh-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],1N82_B The high-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],3MUA_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUA_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
2Q8X_A	5.09e-157	10	335	6	331	Thehigh-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],2Q8X_B The high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],3MSD_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSD_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MUI_A	2.07e-156	10	335	6	331	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUI_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MS8_A	4.16e-156	10	335	6	331	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MS8_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
6WQW_A	5.26e-148	9	336	3	330	ChainA, Beta-xylanase [Thermobacillus composti]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45703	1.87e-149	10	334	6	329	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
O69231	3.11e-146	10	333	6	329	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P23556	5.61e-120	11	333	16	340	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynA PE=1 SV=1
Q12603	1.81e-118	10	333	33	350	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1
P10474	6.74e-99	4	335	37	372	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002414_05154.