CAZyme Information: MGYG000002414_05549

Basic Information

• Species: Paenibacillus odorifer
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus odorifer
• CAZyme ID: MGYG000002414_05549
• CAZy Family: GT2
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1268	MGYG000002414_1|CGC117	145313.22	5.7899

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002414	6802552	Isolate	South Korea	Asia

• Gene Location: Start: 6206718; End: 6210524 Strand: -

Full Sequence      

MNEATNLVQNIIERNHIKKNILRQTTRLNSLEVENASVGTHGLLVSENNKSVFINFKLET
SKKYYKLVYNISNTETTGEVILHVKGNNQRHEKYHLGTFYGTPIVYFLKCDFDAEIITLE
IAEASSFTLGQLELIQISNSEYKANKLKQYTGKLRRVVSKQPHLRAKFFKELKENGLKQA
IQKTKSKLYQNVDSYNNIQVSGQNFKREISLKQSNTVLFVSHDAQNAGASILSLNIVKTL
KKVFNKDVIVLLLKGGPLVNEFSKYATIINFNQNSLSYLENEEEVNKIINEFKDKGVNIC
ISNSVVSNILTKLMFEHGIKVISLVHELPTSIKTYDFIEAANYAVQYSDKIVFPNNFVRE
SFADCFPVDEKKVHIRPQGIYNKRRGALDKQAAKKKLCENLKIEPDSTILLGGGYGDLRK
GFDIFFSIAKEMLVGENGGKLHFVWVGQVEPILEKWMKHDAEILKLDSYIHQIDFQTNLS
PILQGADLFLLPSREDPFPSIVLEAIDNGTPTVTFEGNGGMGEFIKRLGVRPAPYLNTKD
FASEIYRILGDEQSYESIKQLGLELIEKELDFSDYVNQLLHMTQGEETFSKEVSVIIPNY
NYENYIEDRLNSIIYQTVKPKEIIFLDDMSNDNSVQVAERILKRSNIPYKIIKNEVNVGC
FGQWIRGIKEATGDLIWIAEADDLCESNMLEKLIPSFDDDEVNLAYCQSEIIDGNSTKVG
YIYSEYTKDLSLTKWDSSYCIEGREEVVEGLAIKNTIPNASAVLFRSSALEGLEEMLCDY
KIGGDWLAYLYALKLGKISFVSDILNYHRRHSSSIVSRSEQKLELFKEMLAIKLFILENF
EIPGFIVDRFLQHIPNEYARLGCKGYESKDILKNDVLADKFLNLENEARKKVNSVNYLRI
KKRILFVAPDFEVGGGQMLVVRLANFFASFQDVYVYNARPWLEDSMMSGMISRNVNVLKS
NGNPDELRSYINDLKIEVINSHIWWSDKITYHAIQGNQNINWVLAMHGCYEALIENPDWD
NDFSSLVKPVLDRANSIIYATNKNKRVFDTVEVNNIDKLYKVYYGYQLQNIGLKDKTELG
IAEDDFVFGLVSRAIKEKGWEESITAVINLNEELERKIHLILVGHGQYANEMREKYKDNK
FIHFIMDLKKPSEWIGWVKAFDVAILPSYFISESLPNSIIEYLAYDKPVISTNIGEIPKM
LHSVEEDKYAGIILELNEERIVDVQELTDAMRVMVTDSGQYSEYAKNTKLLFEQFKMSNF
ASAYFRLF

Enzyme Prediction     

No EC number prediction in MGYG000002414_05549.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	594	722	7.6e-29	0.7529411764705882
GT4	1081	1244	6.4e-17	0.95625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.47e-28	903	1254	1	350	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
pfam00535	Glycos_transf_2	2.82e-26	594	717	1	123	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04196	GT_2_like_d	2.96e-25	594	816	1	210	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd03801	GT4_PimA-like	4.48e-24	217	580	2	362	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03811	GT4_GT28_WabH-like	6.40e-24	217	526	2	302	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV36047.1	0.0	1	1268	1	1268
AIQ76764.1	0.0	1	1268	1	1268
AFC27517.1	0.0	10	1268	12	1272
AHA08907.1	4.74e-130	217	842	7	622
QWG95856.1	4.74e-130	217	842	7	622

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	1.33e-13	593	829	7	248	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	5.58e-07	592	688	6	100	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5MLZ_A	7.59e-07	590	782	22	201	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]
2IW1_A	4.07e-06	326	514	115	299	CrystalStructure of WaaG, a glycosyltransferase involved in lipopolysaccharide biosynthesis [Escherichia coli str. K-12 substr. W3110]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P22639	9.08e-15	592	822	2	226	Uncharacterized glycosyltransferase alr2836 OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=alr2836 PE=3 SV=2
A0A0H2UR96	1.47e-11	590	832	2	237	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
B5L3F2	3.72e-10	593	716	6	126	UDP-Glc:alpha-D-GlcNAc-diphosphoundecaprenol beta-1,3-glucosyltransferase WfgD OS=Escherichia coli OX=562 GN=wfgD PE=1 SV=1
P11290	5.40e-10	590	710	5	123	Uncharacterized glycosyltransferase YibD OS=Escherichia coli (strain K12) OX=83333 GN=yibD PE=3 SV=2
P71057	7.20e-10	593	823	6	226	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002414_05549.