CAZyme Information: MGYG000002415_03017

Basic Information

• Species: Proteus sp001722135
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus sp001722135
• CAZyme ID: MGYG000002415_03017
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223	MGYG000002415_73|CGC2	24815.26	9.8507

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002415	4051274	Isolate	not provided	not provided

• Gene Location: Start: 232736; End: 233407 Strand: -

Full Sequence      

MKVKIIFSLAILLLAGCAEHARQPVQKETPRFLSQKPVENRINNASISTAQWKSTPFDNH
IQQASSRYDVDETLIKAIIQVESNFRPEVISKSNAVGLMQIKASTAGRDVYQNRGKAGQP
TTAQLKDPAINIDLGTAYIQLLRERHLVGIIDPETLYYATILAYVNGAGALLRTFDKDRN
NAIAKINSMSADDFYRYVEKNHPASQAPRYLAKVRAAYHAGDN

Enzyme Prediction     

No EC number prediction in MGYG000002415_03017.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	72	220	9.6e-21	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	5.69e-78	61	219	3	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK15470	emtA	1.31e-68	1	220	1	202	membrane-bound lytic murein transglycosylase EmtA.
PRK11671	mltC	8.85e-61	61	217	196	352	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	5.32e-27	61	186	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16896	LT_Slt70-like	6.47e-23	61	145	8	90	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQP25311.1	4.47e-154	1	223	1	223
QPB79304.1	4.47e-154	1	223	1	223
QHN10463.1	6.36e-154	1	223	1	223
QKJ47948.1	6.36e-154	1	223	1	223
ATN00782.1	3.68e-153	1	223	1	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8P_A	8.95e-57	62	220	27	185	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	1.18e-56	62	220	44	202	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GHY_A	2.54e-56	62	220	27	185	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	2.54e-56	62	220	27	185	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]
6GI4_B	2.54e-56	62	220	27	185	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7LSJ1	9.35e-61	7	217	6	199	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=emtA PE=3 SV=1
B7UQ77	3.49e-58	7	220	6	202	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=emtA PE=3 SV=1
A8AFS5	3.49e-58	7	220	6	202	Endo-type membrane-bound lytic murein transglycosylase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=emtA PE=3 SV=1
C4ZTN4	7.01e-58	7	220	6	202	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=emtA PE=3 SV=1
B7NUV4	7.01e-58	7	220	6	202	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) OX=585057 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000068	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002415_03017.