CAZyme Information: MGYG000002416_00633

Basic Information

• Species: Hydrogeniiclostridium mannosilyticum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Hydrogeniiclostridium; Hydrogeniiclostridium mannosilyticum
• CAZyme ID: MGYG000002416_00633
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
671	MGYG000002416_1|CGC3	75973.13	4.8814

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002416	3014016	Isolate	Russia	Europe

• Gene Location: Start: 679717; End: 681732 Strand: -

Full Sequence      

MLESALNPQAGKAQWIWYPGDFEMMLLLRVHSRRYERGMQITPCWHMDTFFPNIKFRRRF
HLEKPVVFQVHATGEVAVEVDGGGRYCYDYQDGVRLEPGSHDLCITVFNPHELPALYIDA
DGLQTNGAWEASNVDSRWLPAGSWNFTSPSCPPSDFRLEMQPLQPVSVEKIGQGVLFDFG
KEMMASLKGEGFKGEGILHISYGESREEALNYAECEVREDVKVTEDCFETTLPRAFRFVF
LAPEGGLSAGGLTALYEYLPIENKGSFECSDDLLNRIYDTAVYTLHLNSREFFFDGIKRD
RWVWGGDACQSYLLNYYSFFDSELCKRTMRALRGKDPVHQHHNTIQDYTCYWFISLYDYY
LYTGDAAFLREVYRNARTLMDFCLETTDERGFMNARPEDWVFVDWAPINNKGDVSLIQIL
FARSLEVMALIAGLCGDENGRAFYHSLWQKCLKNCFEIFWSARYNCFTHGPAAASDAVVT
KYANMFALSFGYLSEEQKAAVIQNALLNETVLPITTPYMRFYELAALCDAGCYEDVMGFL
REYWGGMLRLGATSFWEAYDAAEQGAQHYAMYGRPFGKSLCHAWGAGPILLAGKYFLGVR
PEAPGYEKFTVSPHLAGLAYIRGSVPTPGGTIDVFCDGEKAEVVNHTPFEGALEWKGQVV
AVPPGQTVSLG

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	174	636	8.1e-97	0.9384920634920635

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.40e-25	265	595	4	339	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam06202	GDE_C	2.77e-07	352	505	88	259	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	9.31e-06	261	382	234	374	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam17390	Bac_rhamnosid_C	0.001	598	634	1	38	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG4354	COG4354	0.006	347	464	442	569	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEL00882.1	3.93e-215	12	643	32	680
QJD97300.1	2.72e-212	12	662	8	675
QIK55686.1	1.06e-210	5	647	16	677
QDH81526.1	5.00e-210	9	658	25	691
AYQ71539.1	1.94e-208	7	656	4	659

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.09e-188	15	643	20	683	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	9.61e-38	234	630	503	910	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	1.64e-27	229	597	164	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
6I60_A	1.52e-07	82	634	250	873	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	8.71e-10	163	634	355	853	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	2.37e-08	261	502	486	746	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002416_00633.