CAZyme Information: MGYG000002418_00966

Basic Information

• Species: Parabacteroides chinchillae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides chinchillae
• CAZyme ID: MGYG000002418_00966
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000002418_1|CGC14	43367.29	9.1982

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002418	3822361	Isolate	not provided	not provided

• Gene Location: Start: 1070636; End: 1071769 Strand: +

Full Sequence      

MKYYLIAGEASGDLHASNLMAALKEQDKEADFRFLGGDLMQAVGGTLVKHYREMAFMGFI
PVLLNLRTILKNMQTCEEDISRYQPDVVILIDYPGFNLKIAKFVKTVLHLPVYYYISPKI
WAWKQYRIKDFRKYVDKMFCILPFETEFYHKLNYTVDYVGNPSVDSVALYMEQKAVSRDI
FYKEENLNDKPILALLAGSRRQEIKDNLPTMLNVAASYPDYQPIIAGAPGISPDFYNNYT
GNHPVKIIFGKTYPLLQHSKAALVTSGTATLETSLFRIPQVVCYYTPAGKLASFIFRHFF
HTKYISLVNLIAGREVVQELFGARFSRQQIQEELGRILQNKEYRQKMLDGYDEVIRILGK
PGASERTARLIYHSLLH

Enzyme Prediction     

No EC number prediction in MGYG000002418_00966.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	357	7.7e-112	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.38e-108	1	371	2	371	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.76e-99	1	371	2	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.15e-75	4	366	2	366	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	9.63e-65	5	368	10	379	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.03e-45	1	372	2	345	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK92630.1	5.00e-228	1	375	1	375
QUR47916.1	5.00e-228	1	375	1	375
ABR44355.1	2.37e-226	1	375	1	375
QRO15504.1	2.37e-226	1	375	1	375
QCY57761.1	2.37e-226	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	6.68e-36	5	371	11	377	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	6.68e-36	5	371	11	377	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	4.24e-64	2	375	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	4.53e-55	5	368	8	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	6.52e-55	2	375	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B6J161	4.10e-54	5	373	8	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	5.75e-54	5	373	8	372	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002418_00966.