CAZyme Information: MGYG000002418_01369

Basic Information

• Species: Parabacteroides chinchillae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides chinchillae
• CAZyme ID: MGYG000002418_01369
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
698	MGYG000002418_1|CGC24	78252.2	5.6086

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002418	3822361	Isolate	not provided	not provided

• Gene Location: Start: 1540592; End: 1542688 Strand: -

Full Sequence      

MKLYALTLPACLLLGAVACSPGEQENTDTGIHFLEVNQVKVQDAFWKPKFEQWNKVTTND
VFDKFEGKHLHNPDPKKMHNTFENFDRVANGERNVGDHAGMPWFDGLVYETIRGVSDLIA
QQSNPDLEQRVDGYIDRIAKAQASDPDGFINTYTQMMEDNHRWGENGGMLRWQHDVYNAG
MLVEAGVHYYNATGKTKLLEVATRFANHMCDYMGPYPKKNIVPAHSGSEEPLVKLYWLYK
NNPDLKQKVSVPVNEQAYFDLATFWIENRGHNCGQPLWLTWGNPAAEQWIRDNKYADPQF
GNHSRPSFGDYAQDSLPLFQQQTIEGHAVRATLFTTGVAAAALENKNPDYIAAVTRLWDN
MVGKRMFVTGGVGAVHFDEKFGPDYYLPTDAYLETCAAVGAGFFSQRMNELTGDGKYMDE
FERSLYNNVLTGISLSGDHYTYQNPLNAEKHARWEWHECPCCPPMFLKMVSAVPGFIYSH
QGNTISVNLFIGSEATVNLSKNLSVAVKQETRYPWDGSVTLTVDPAKPADFALRVRIPGW
AQGVENPYGLYKSDVNSPAELKVNGEPVQMNVVKGYAEINRKWAKGDKVELSLPMQPRII
TANGSVTDLNGMVALASGPLVYCLEGCDNTDLKDIRFDTRSPMSLNYRSDLLSGINVIEG
KAFDKDEKEIAVSAIPYYAVGNRTEGDAYKVWLPVKGK

Enzyme Prediction     

No EC number prediction in MGYG000002418_01369.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	39	623	4.6e-180	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.97e-171	38	623	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	8.07e-130	100	693	60	585	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CUA16969.1	0.0	1	694	1	692
QTO26887.1	0.0	1	694	1	692
ANQ62633.1	0.0	1	694	1	692
CAH06087.1	0.0	1	694	1	692
QKH85488.1	0.0	1	694	1	692

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	2.49e-114	39	695	15	625	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	2.80e-108	39	696	16	648	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.34e-104	39	696	16	648	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.66e-77	53	695	46	696	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	1.96e-73	87	687	58	651	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.08e-72	87	687	58	651	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000112	0.101685	0.898099	0.000039	0.000044	0.000039

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002418_01369.