CAZyme Information: MGYG000002418_01371

Basic Information

• Species: Parabacteroides chinchillae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides chinchillae
• CAZyme ID: MGYG000002418_01371
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
801	MGYG000002418_1|CGC24	89858.11	7.146

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002418	3822361	Isolate	not provided	not provided

• Gene Location: Start: 1543849; End: 1546254 Strand: -

Full Sequence      

MKKTTTTLVITLLSVFSGYAANDGRSKIHEVPFTSVHCTDNFWAPRIDTIRTKTIPYAFS
RSEKAGYIDNFAIAGGLKEGKYQSAFPFDDAEVYKIAEGASYLLTVKKDTRLEAYMDSII
AIIASAQEPDGYLFTNHTINNPLHPWVGKERWVQDWDLSHETFNAGELYEAAIAYYYATG
KRSLLDVAIKNADLICSVFREGGLKIAPGHEVIEMALVRLYEATGDEKYLKQCRYFLESR
GHKVFDKTSADIRKNGMYWQDHLPVTQQREAVGHAVRALYLYSGMADIALHMQDKAYLNA
IDSIWSNIVGKKMYLTGGLGSTANNEAFGKNYELPNATAYCETCASIANCMFNLRMFKLH
GDAKYIDVLERSLYNTVLSGISISGDMFFYPNVLETNKNGQERSLWFDCSCCPTNLSRFI
PAVPGYIYAVDDKSIYANLFVGGSGEVQFNGRKVLLEQQTDYPWSGDVAITVNPVETNSF
DLKIRIPGWAKESVVPSDLYSFVGKQKGNVQIFLNGKPYKYQQEKGYAIIANKWKKGDRV
TVSFPMEPRQVITNDAVKTNNGLVAVERGPLVYCAEFVDNNGEVRNLSLSGKTSYEVKKR
PDLMNGIYTIIAAGKKYTAKAGGKEIQSEDTPITFIPYYARAYRGAGEMKVWLPRNGEKI
VSNLQEELRVVDEVLIGHEESESAHNLQGKNTRADKSGGWRDAQDGWFSYDLKVLPDKPM
ELVLTYHSTDGGNRQFEIWVGDTKIAEQSLRTETFDLFIDHPYLLPEALTRGKEKVTVKL
QALPGNVAGGIFGCKMRYVTK

Enzyme Prediction     

No EC number prediction in MGYG000002418_01371.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	36	574	5.5e-199	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.30e-167	35	574	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.23e-145	24	657	5	589	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04791	LanC_SerThrkinase	8.30e-05	179	319	102	244	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SIP56265.1	0.0	18	797	7	783
QJR78611.1	0.0	1	801	1	807
QUT86297.1	0.0	1	801	1	807
AND18710.1	0.0	1	801	1	807
AII65963.1	0.0	1	801	1	807

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	8.62e-221	28	654	7	624	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	2.47e-153	34	653	14	645	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	6.41e-147	34	653	14	645	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	2.32e-103	1	654	1	695	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	8.79e-103	35	655	2	658	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	4.81e-102	35	655	2	658	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000382	0.998858	0.000236	0.000183	0.000156	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002418_01371.