CAZyme Information: MGYG000002418_01375

Basic Information

• Species: Parabacteroides chinchillae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides chinchillae
• CAZyme ID: MGYG000002418_01375
• CAZy Family: CBM66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811	MGYG000002418_1|CGC24	90683.46	5.6454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002418	3822361	Isolate	not provided	not provided

• Gene Location: Start: 1550717; End: 1553152 Strand: -

Full Sequence      

MKIDKLKKYALLGGSILAFIPCEVFAQNSKITVDASKVMNEIPAYLYGACIEDVNHEIYG
GLYDQKVFGESFEEPVRGFVFESFSIYEGFWTPQKDGVIADAFPGAKLVYEHADIEKGSV
EVELRMKGTAANNAGLLVRVNNPGKGADRFDGYEVSLASDGAKVMFGKHCQNWQPLKEVF
VHCSPDEWNAMKVEMSGAQIEVFLNGKSLFVYEDKDSPILNGKVALRTWGSDVEFRNLAI
EKNGKKEPVSYSGKKGLPVSMHWDAIQTGSAKAVFSHDDKDAFNGRYSQSIEMIGSKGTV
GIANQSLNRWGISVEEGQAFQGQIYLKGDSYRGLVTVALQSADGSKEYASQVLNNIASEW
KKYPIHLLSNTTDPKSRLAVYINRPGKIWIDQATLMATGNKQFHGLPYRNDIGQAMQKQG
LTFLRYGGTMVNAPGYRFKKMIGDPDRRPPYKGHWNPYSTNGFGIEDFLKYCEAAGFVAS
FAVNIEETPEDIADMVEYLNGSLSSVWGKKRAENGHHEPYCVKYIEIGNEEVIHADDAEG
YKHYIDRFNLLYDAIKSKDASVDVVNAAWWRPDSPNMEMVFKALNGKSPYWDYHPWADDA
NAGVNVEKELKRMQELFLKWDPNTQMKCAIFEENGNLHNMQRALGHVTLQNAVRRCGDFV
LTSCAANALQPYLQNDNGWDQGQIFFTPLQVWGMPPYYAQQMASENHLPLRVYSEETGDL
DVTATRDGRGELLVLHVANINDKPVLASLNIEGFGNASQVEVVTLSADLDGRNTPEQPCK
IIPVKSSLLGDNKMDYEFPSHSYVVMKFVKQ

Enzyme Prediction     

No EC number prediction in MGYG000002418_01375.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	390	810	6.7e-54	0.6793650793650794
CBM66	84	237	1.1e-23	0.9548387096774194

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3534	AbfA	1.39e-32	408	811	50	501	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].
smart00813	Alpha-L-AF_C	3.26e-24	638	802	18	189	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
pfam06964	Alpha-L-AF_C	1.33e-18	620	802	6	192	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
pfam06439	DUF1080	1.04e-14	95	241	28	182	Domain of Unknown Function (DUF1080). This family has structural similarity to an endo-1,3-1,4-beta glucanase belonging to glycoside hydrolase family 16. However, the structure surrounding the active site differs from that of the endo-1,3-1,4-beta glucanase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL02085.1	0.0	6	806	5	807
BBL12837.1	0.0	6	806	5	807
BBL10044.1	0.0	6	806	5	807
AKA54044.1	0.0	1	810	1	799
CUA16970.1	0.0	1	810	1	799

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	6.15e-18	295	806	89	622	ChainAAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]
4ATW_A	1.25e-13	408	807	49	480	Thecrystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_B The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_C The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_D The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_E The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8],4ATW_F The crystal structure of Arabinofuranosidase [Thermotoga maritima MSB8]
3S2C_A	1.26e-13	408	807	49	480	Structureof the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_B Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_C Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_D Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_E Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_F Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_G Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_H Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_I Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_J Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_K Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3S2C_L Structure of the thermostable GH51 alpha-L-arabinofuranosidase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1]
3UG3_A	1.34e-13	408	807	69	500	Crystalstructure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_B Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_C Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_D Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_E Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG3_F Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima ligand free form [Thermotoga maritima],3UG4_A Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_B Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_C Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_D Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_E Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG4_F Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima arabinose complex [Thermotoga maritima],3UG5_A Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_B Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_C Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_D Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_E Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima],3UG5_F Crystal structure of alpha-L-arabinofuranosidase from Thermotoga maritima xylose complex [Thermotoga maritima]
2VRK_A	1.58e-08	409	530	53	176	Structureof a seleno-methionyl derivative of wild type arabinofuranosidase from Thermobacillus xylanilyticus [Thermobacillus xylanilyticus],2VRK_B Structure of a seleno-methionyl derivative of wild type arabinofuranosidase from Thermobacillus xylanilyticus [Thermobacillus xylanilyticus],2VRK_C Structure of a seleno-methionyl derivative of wild type arabinofuranosidase from Thermobacillus xylanilyticus [Thermobacillus xylanilyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9SG80	8.78e-37	298	811	139	658	Alpha-L-arabinofuranosidase 1 OS=Arabidopsis thaliana OX=3702 GN=ASD1 PE=1 SV=1
Q8VZR2	1.11e-30	298	803	138	647	Alpha-L-arabinofuranosidase 2 OS=Arabidopsis thaliana OX=3702 GN=ASD2 PE=2 SV=1
U6A629	5.77e-26	290	565	97	388	Alpha-L-arabinofuranosidase A OS=Penicillium canescens OX=5083 GN=abfA PE=1 SV=1
Q0CTV2	6.94e-24	298	806	112	625	Probable alpha-L-arabinofuranosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=abfA PE=3 SV=1
B8NKA3	8.31e-22	295	774	109	582	Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000681	0.958972	0.039569	0.000285	0.000234	0.000219

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002418_01375.