CAZyme Information: MGYG000002418_03331

Basic Information

• Species: Parabacteroides chinchillae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides chinchillae
• CAZyme ID: MGYG000002418_03331
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261	MGYG000002418_8|CGC1	29557.6	7.6689

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002418	3822361	Isolate	not provided	not provided

• Gene Location: Start: 7247; End: 8032 Strand: -

Full Sequence      

MKTLNSFFFVALCLLFSITSYAGDKASFLKKQFTAANGYKLNYRVLYPENYCPDQQYPVI
LFLHGAGERGDDNEAQLFHGGDMFASYTNQSKYPAIVIAPQCPKDLWWSSYQRPEKEGEK
RYYPTVAPITKTMAAVKELLDSYIAKGIVDTKRIYITGLSMGGMGTFDLVCRYPNLFAAA
TPICGGANLQRLTNFKGKTAFSIYHGADDSVVDVQFSRDAYETLKKAGVDVRYKEYPGVD
HNSWDNAFAEPDYLDWMFRHK

Enzyme Prediction     

No EC number prediction in MGYG000002418_03331.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	37	242	3.4e-34	0.8986784140969163

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	3.82e-46	38	261	171	386	Predicted peptidase [General function prediction only].
COG1506	DAP2	7.21e-15	17	260	350	616	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
pfam02230	Abhydrolase_2	5.80e-14	47	244	3	202	Phospholipase/Carboxylesterase. This family consists of both phospholipases and carboxylesterases with broad substrate specificity, and is structurally related to alpha/beta hydrolases pfam00561.
COG0400	YpfH	3.46e-12	47	238	7	186	Predicted esterase [General function prediction only].
TIGR01840	esterase_phb	1.13e-09	51	186	4	129	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61582.1	9.81e-45	43	258	827	1039
ABS60377.1	9.05e-42	40	261	21	244
QDU56037.1	1.73e-32	17	261	775	1006
VTR91196.1	5.00e-29	40	261	42	238
QJW99051.1	8.53e-28	40	261	43	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	8.59e-45	38	258	155	376	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	1.14e-23	38	261	18	216	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
6AVW_A	1.81e-12	60	242	8	195	Crystalstructure of Arabidopsis thaliana SOBER1 L63A [Arabidopsis thaliana]
6AVV_A	2.48e-12	60	242	8	195	Crystalstructure of Arabidopsis thaliana SOBER1 [Arabidopsis thaliana]
6AVX_A	2.48e-12	60	242	8	195	Crystalstructure of Arabidopsis thaliana SOBER1 F65L [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q84WK4	1.32e-11	60	242	6	193	Carboxylesterase SOBER1 OS=Arabidopsis thaliana OX=3702 GN=SOBER1 PE=1 SV=1
B8YG19	3.81e-07	130	244	122	244	Bifunctional acetylxylan esterase/xylanase XynS20E OS=Neocallimastix patriciarum OX=4758 GN=xynS20E PE=1 SV=1
P52090	4.33e-06	135	186	129	180	Poly(3-hydroxyalkanoate) depolymerase C OS=Paucimonas lemoignei OX=29443 GN=phaZ1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000234	0.999160	0.000153	0.000158	0.000139	0.000132

TMHMM  Annotations     

start	end
7	24