CAZyme Information: MGYG000002419_00484

Basic Information

• Species: Phoenicibacter congonensis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Phoenicibacter; Phoenicibacter congonensis
• CAZyme ID: MGYG000002419_00484
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	MGYG000002419_1|CGC5	46362.87	8.9521

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002419	1447956	Isolate	not provided	not provided

• Gene Location: Start: 549823; End: 551064 Strand: -

Full Sequence      

MQDKRKIYVSHASVGSGHKTAAHAISLATEMLQKEAGVAADYEPEMIDILDYGRIKFDGN
KYATTFTGATRPIYDITWRYTFTGRILWGGGTSFAHVMFPKFTKKVREEKPAAIICTHIT
AANAAVGAKIITKQNFPIICVPTDYEVEGLWPHSYTDLFCVANEEMAETLRARHIPEDKI
KITGMPTNPEFIQEYDRDEVCKEFNLPANKKLVLTIAGASLLQPYIHIKKVIENLVPHMQ
EFKNLHFVIVVGKDSEMKRELKSFKEKHRIENITVLGYVEQMAMLLNACDLVVCKAGGMT
VTECLCAGTPMILTCRAYGQEKANVKMLTAAGAAVHVTTSRELWSTLMQTDKNPHAHDGL
KYAAMNIRKPNASIDIARETLLKIDEANQTLKNGKPRRHFIKIYIGNKPVHPR

Enzyme Prediction     

No EC number prediction in MGYG000002419_00484.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	227	370	3.7e-26	0.9044585987261147

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	1.50e-63	11	386	5	364	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK13609	PRK13609	4.17e-35	1	381	1	366	diacylglycerol glucosyltransferase; Provisional
PRK13608	PRK13608	4.87e-32	108	389	102	374	diacylglycerol glucosyltransferase; Provisional
COG0707	MurG	3.10e-27	104	381	85	352	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	2.77e-22	99	379	78	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS57039.1	1.66e-151	11	413	2	410
ATP53616.1	2.56e-151	2	413	28	433
QIA34715.1	4.69e-151	4	413	17	420
BCA88843.1	1.38e-150	7	413	71	483
AZH69564.1	4.18e-150	2	413	28	433

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	2.65e-06	178	373	160	355	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54166	2.66e-27	132	395	124	379	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=ugtP PE=1 SV=1
A8FED1	2.23e-25	132	395	124	376	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus pumilus (strain SAFR-032) OX=315750 GN=ugtP PE=3 SV=1
Q65IA4	7.81e-25	137	395	129	376	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ugtP PE=3 SV=1
Q49WE6	6.71e-23	101	324	95	309	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=ugtP PE=3 SV=1
B9DQ98	1.24e-22	108	389	102	374	Processive diacylglycerol beta-glucosyltransferase OS=Staphylococcus carnosus (strain TM300) OX=396513 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002419_00484.