CAZyme Information: MGYG000002420_00752

Basic Information

• Species: Clostridium_E merdae
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Clostridium_E; Clostridium_E merdae
• CAZyme ID: MGYG000002420_00752
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	MGYG000002420_3|CGC2	38719.17	4.8073

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002420	2748860	Isolate	not provided	not provided

• Gene Location: Start: 418833; End: 419873 Strand: +

Full Sequence      

MNTASAGFFRHIEKESILGENPPFKACHSSTLAVLPNGDLFCVWFAGSHEGEDDVAIWGA
RRTGGKWLAPQVLQQNGLPHWNPVLFVKKDGSVLLFYKVGREIASWQTWVCESNDNCLTW
SPVRELVPGDVGGRGPVRNKLIVHSSGRWLAPASLEDGVWRSFADYSDDDGKTWVKSNEV
FIPLEKVATKSETYQEIPVSVQSFGGRGAIQPTLWESQDGNVHMLMRTSEGYIARSDSQD
GGKTWCEGYSTSLPNNNSGIDLVKAYDGRLFLVYNPVGENWGPRFPLRLACSHDDGQTWE
DVYTLEETEGEYSYPSINCNGDTLYVTYTNCRKDISFWSLQLNKPE

Enzyme Prediction     

No EC number prediction in MGYG000002420_00752.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	23	329	1.3e-33	0.9035087719298246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	4.75e-86	38	325	1	278	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4692	COG4692	7.37e-60	3	341	8	372	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd15482	Sialidase_non-viral	1.04e-48	23	340	10	338	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS21221.1	2.09e-132	9	343	2	338
AUS95056.1	3.97e-129	9	340	2	331
AZS14954.1	1.31e-123	9	337	2	331
QTV77693.1	2.39e-121	23	336	11	326
ACX65278.1	3.57e-113	14	344	8	327

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YA4_A	3.20e-07	109	344	238	484	Crystalstructure of Streptococcus pneumoniae NanA (TIGR4) [Streptococcus pneumoniae TIGR4],2YA4_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) [Streptococcus pneumoniae TIGR4],2YA5_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with sialic acid [Streptococcus pneumoniae TIGR4],2YA5_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with sialic acid [Streptococcus pneumoniae TIGR4],2YA6_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with DANA [Streptococcus pneumoniae TIGR4],2YA6_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with DANA [Streptococcus pneumoniae TIGR4],2YA7_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_C Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA7_D Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Zanamivir [Streptococcus pneumoniae TIGR4],2YA8_A Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Oseltamivir carboxylate [Streptococcus pneumoniae TIGR4],2YA8_B Crystal structure of Streptococcus pneumoniae NanA (TIGR4) in complex with Oseltamivir carboxylate [Streptococcus pneumoniae TIGR4]
5KKY_A	3.21e-07	109	344	241	487	Structureof Streptococcus pneumonia NanA bound with inhibitor 9N3Neu5Ac2en [Streptococcus pneumoniae],5KKY_B Structure of Streptococcus pneumonia NanA bound with inhibitor 9N3Neu5Ac2en [Streptococcus pneumoniae]
6QZH_A	3.88e-07	109	344	426	672	Structureof the human CC Chemokine Receptor 7 in complex with the intracellular allosteric antagonist Cmp2105 and the insertion protein Sialidase NanA [Homo sapiens]
4X6K_A	5.61e-07	135	306	267	424	Crystalstructure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with Siastatin B [[Ruminococcus] gnavus CC55_001C]
4X47_A	5.63e-07	135	306	270	427	Crystalstructure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with Neu5Ac2en [[Ruminococcus] gnavus ATCC 29149],4X49_A Crystal structure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with oseltamivir carboxylate [[Ruminococcus] gnavus ATCC 29149],4X4A_A Crystal structure of the intramolecular trans-sialidase from Ruminococcus gnavus in complex with 2,7-Anhydro-Neu5Ac [[Ruminococcus] gnavus ATCC 29149]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002420_00752.