CAZyme Information: MGYG000002421_01329

Basic Information

• Species: CABMKH01 sp902386935
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Tissierellaceae; CABMKH01; CABMKH01 sp902386935
• CAZyme ID: MGYG000002421_01329
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	MGYG000002421_5|CGC5	36496.54	4.6274

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002421	2734249	Isolate	not provided	not provided

• Gene Location: Start: 225347; End: 226288 Strand: +

Full Sequence      

MKKTILISLIVVLLVFGSTAQASRLGFTEEQYEYMMLENEKLRREYKNIEKDYAALQEKN
QELQREIDQLKKLMEKDIAKEIPVLLYHHILPQEDMDKYGWNGNDSVISLENFREQMKYL
KDNDFHTANLDELEAFIKGEQILPKNTVVITFDDGYLSNIVHAYPIMKEYGFNGIIFIIG
DSENREKEEYDPATTQRIYLPEAKNYSDVFEYGCHSYGFHFLEDGHTMLEVLDKEAIKTD
LKRSKALLGARAIAYPFGRYSEDALQAVEELNYILGFTVEQEYVKQGDSPYELPRFIINP
QMGIEGFIKIISR

Enzyme Prediction     

No EC number prediction in MGYG000002421_01329.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	143	273	3.1e-21	0.8923076923076924

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10966	CE4_yadE_5s	5.11e-56	144	307	1	164	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.
cd10969	CE4_Ecf1_like_5s	1.79e-40	111	296	2	200	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10918	CE4_NodB_like_5s_6s	2.27e-38	147	300	1	156	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
TIGR03938	deacetyl_PgaB	2.44e-24	84	307	5	257	poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB. Two well-characterized systems produce polysaccharide based on N-acetyl-D-glucosamine in straight chains with beta-1,6 linkages. These are encoded by the icaADBC operon in Staphylococcus species, where the system is designated polysaccharide intercellular adhesin (PIA), and the pgaABCD operon in Gram-negative bacteria such as E. coli. Both systems include a putative polysaccharide deacetylase. The PgaB protein, described here, contains an additional domain lacking from its Gram-positive counterpart IcaB (TIGR03933). Deacetylation by this protein appears necessary to allow export through the porin PgaA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0726	CDA1	1.15e-20	82	308	1	218	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU29695.1	3.39e-47	82	312	72	309
AEE91926.1	1.49e-42	82	311	47	277
CCP26752.1	1.49e-42	82	311	47	277
BAD41335.1	1.60e-34	84	312	1	226
ADG83187.1	1.43e-29	77	312	34	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DQ3_A	1.41e-16	81	312	8	229	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]
4WCJ_A	2.16e-15	84	300	39	250	Structureof IcaB from Ammonifex degensii [Ammonifex degensii KC4]
3VUS_A	1.60e-09	114	311	34	264	Escherichiacoli PgaB N-terminal domain [Escherichia coli K-12],3VUS_B Escherichia coli PgaB N-terminal domain [Escherichia coli K-12]
4F9D_A	3.73e-09	114	311	38	268	Structureof Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12],4F9D_B Structure of Escherichia coli PgaB 42-655 in complex with nickel [Escherichia coli K-12]
4F9J_A	8.86e-09	114	311	38	268	Structureof Escherichia coli PgaB 42-655 in complex with iron [Escherichia coli K-12],4F9J_B Structure of Escherichia coli PgaB 42-655 in complex with iron [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31666	6.64e-31	82	312	170	404	Uncharacterized protein YadE OS=Escherichia coli (strain K12) OX=83333 GN=yadE PE=3 SV=2
P94361	9.23e-22	62	307	45	271	Putative polysaccharide deacetylase YxkH OS=Bacillus subtilis (strain 168) OX=224308 GN=yxkH PE=3 SV=1
Q5HKP8	4.08e-12	104	299	73	271	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaB PE=3 SV=1
Q6TYB1	4.08e-12	104	299	73	271	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus epidermidis OX=1282 GN=icaB PE=1 SV=2
P75906	2.11e-08	114	311	75	305	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=pgaB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000272	0.999084	0.000168	0.000160	0.000153	0.000141

TMHMM  Annotations     

start	end
5	27