CAZyme Information: MGYG000002422_01079

Basic Information

• Species: Campylobacter_D jejuni
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_D; Campylobacter_D jejuni
• CAZyme ID: MGYG000002422_01079
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1578		187308.36	8.6903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002422	1714563	Isolate	United Kingdom	Europe

• Gene Location: Start: 11283; End: 16019 Strand: -

Full Sequence      

MKYCMFGLYFLFASILYKRKKYQASKKYFIKASNNFRDNAKAYFKTGMCCFHLKEWNDAK
VFFEQACFLKETPNWRKQLKQVYNHLKFGFFLEQKLWWKEVDRLKQELNHGNEQNFILLR
DLAIACEAMKRYNDAVKYYKESILIQEKQKIPIESVWYYRLGFCCEKIKDIVLSNKFYGY
AIKFDEELESDIYGIGVFHEKMGYWSEANVAYLNKIQELEIVYLDKIFYKIAFSFEMLYD
WKNSEKYYHKAIENNYHCSVYHYRLGVVLEKQNKIEQASIFYTEAFKRDSYCRAEYFYRL
ANCLMKLDHHKEACKIFAQINRINNNIFDQNLNFLKDDFFRQKVIYLDYYENEDILQNAI
LYQTHTAQFMSCNPYAIFLHLLNDPRFDNFIHIWVLQDFESIPLEFRQNKKIIFVKYFSK
LYFKYLASAKYLINSGSFCRFFIRKPEQKYLATWHGTPWKYLGKDMRRGFMEFEVTQKDF
LQSTHIISPNKHTSEVLMQKHDIENIFQGKVYESGYPRIDITLKINNFKKQQIRERLNIK
IGDKVILYAPTYRNSFENAELNIEKLIKDLEIFKKSGFVVVFRGHYNLEDKLKDNGIPSV
PRDIDTNELLSIVDVLITDYSSIAFDFMVLNRPIIYYIYDYEEYKNQHGLYFDVEMLNSV
YCKTPQEVLGILKNPLMLEKCKISQEIKDMFVLNEDGAATQRVIEFFFFDNFKDEKIYKN
FNNKVNLLIYPGGLGNNGMSVSFVNFLNYLNLNEYNVYVAIDSWQVRQSPTCMKYINQIR
DKVYILGNPNILSQTQEENWLLSNPVYKNKRANQEQENIFARCFERDFRCLYGDSKFNSL
ISFDGYGELWVYRFAYAKTNAKKIIYLHNDMKGEFDVRFPYLEKIFNVYKYFDHIFSVSR
ELSDLNRDNLSDTYQVECDKFDFMNNIIDYKNILFKSGFVLEYLEDESIFNDGGKVFINI
ARLSPEKNQLMLIKAFQKISSEFNNIKLMILGDGPLKEDLKLYILKNNVKNVYLLGNRNN
PYPYLRKADCFILSSLHEGQPMVLLESLVLKKPIIATNITGNRSVLNSRGGLLVNPDIDS
LSKAMIKYLKESIQTCNFDFVEYNNIILEKFNYLFGVSFEGYKNDRCILSPCIIMAKPDG
FGMRLFAMMAGLLLSEKTNLPFYFKWGKIEDVIGNTHEMFNSIKHIPFALGKVGDIFSEE
FIQKYYIDDCKDISSNHGFGIHQEKKTFNDIKNGPFEQKWGWYAPGIEGGALSNWIEGYN
EEQCYKDFAEIYKKIKFSNKYQNIIKYAEQTASKLGEFIAIHIRGADIVYSSTYKKASLY
AFVGDKYFPYEIAIEIIKNKIKDYKIVIFSQDIIASKKLIDYFNNEKIILADQFASEFLD
VTERAFFEMNFLSYAKLIYTPGISLQKSAFSQCPSFFSGIKKDISFHEIFSKEKQYQIIE
ENINKLQLDSMYKSMAFFRLYQLSLDLKKDFKISLQFIEKAMLEDASNTAWIIHWIHLNL
RYDHYDIVEKYLDKNLVKIQHDLLVTLLLFRGKIYKNICFDLMKIKKRCEKYSNLLFLIN
EISRSMKKQKKGIAWKKN

Enzyme Prediction     

No EC number prediction in MGYG000002422_01079.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	950	1092	1.1e-30	0.91875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03811	GT4_GT28_WabH-like	6.98e-56	726	1095	1	331	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
pfam04464	Glyphos_transf	3.25e-55	370	708	17	359	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
cd03801	GT4_PimA-like	1.79e-35	826	1090	72	332	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03808	GT4_CapM-like	4.03e-31	918	1087	140	325	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
pfam13692	Glyco_trans_1_4	7.30e-31	954	1090	1	137	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGK83557.1	0.0	1	1578	1	1578
AON65977.1	0.0	1	1578	1	1578
ADZ76237.1	0.0	1	1578	1	1578
VEI83564.1	0.0	1	1578	1	1578
AMP65746.1	0.0	1	1578	1	1577

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	8.85e-30	326	703	317	710	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	6.24e-29	326	703	317	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	1.44e-28	326	703	317	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
4X6L_A	6.25e-11	917	1112	284	479	ChainA, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_C Chain C, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_D Chain D, TarM [Staphylococcus aureus subsp. aureus 21178],4X7P_A Chain A, TarM [Staphylococcus aureus subsp. aureus 21178],4X7P_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178]
4X7M_A	6.25e-11	917	1112	284	479	ChainA, TarM [Staphylococcus aureus subsp. aureus 21178],4X7M_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178],4X7R_A Chain A, TarM [Staphylococcus aureus subsp. aureus 21178],4X7R_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RKI5	1.86e-39	357	705	31	390	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
P13485	9.77e-30	355	704	379	739	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q5HLM5	4.67e-29	326	703	317	710	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q2G1C1	6.52e-29	357	708	27	388	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q58459	9.73e-23	859	1066	110	316	Uncharacterized glycosyltransferase MJ1059 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1059 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.890090	0.106708	0.002731	0.000151	0.000115	0.000205

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002422_01079.