CAZyme Information: MGYG000002423_01343

Basic Information

• Species: Pantoea septica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea septica
• CAZyme ID: MGYG000002423_01343
• CAZy Family: GH102
• CAZyme Description: Membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000002423_2|CGC17	42079.43	9.5009

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002423	4877109	Isolate	United States	North America

• Gene Location: Start: 1419283; End: 1420434 Strand: +

Full Sequence      

MNKGHWAKYALTGAMFALLAGCSSKPTDRGQQYKDGKLEQPLALVNQPNAKGRPVNGRDF
GEQVRQIQSASSALYGRHTGTYSAIESWLMAGADTRQLRQFGLNAFQMEGTDNYGNVQFT
GYYTPVVQARYTRQGEFQYPIYRMPPRKRGAKLPSRASIYSGALDERYVIGWSNSLIDNF
IMDVQGSGYVDYGDGRPMTFFGYGGKNGWAYHSIGKELIDRGEVKREDMSMQAIRDWAAS
HSEQEVRALLETNPSFVFFKPEPYTPVRGASAVPLVAKASVASDRSLIPAGTALLAEVPQ
LNEKGKFNGKYEMRLMVALDVGGAIKGQHFDIYQGIGPDAAHLAGFYNHYGRVWVLKAAP
GAGQPLFSNPQNGDNGSLLLGSN

Enzyme Prediction     

No EC number prediction in MGYG000002423_01343.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH102	127	260	3.7e-40	0.9936305732484076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11162	mltA	0.0	2	357	1	355	murein transglycosylase A; Provisional
COG2821	MltA	1.98e-156	6	364	5	371	Membrane-bound lytic murein transglycosylase [Cell wall/membrane/envelope biogenesis].
cd14472	mltA_B_like	4.38e-60	127	262	1	134	Domain B insert of mltA_like lytic transglycosylases. Escherichia coli MltA is a membrane-bound lytic transglycosylase comprised of two domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, which correspond to the 3D domain, named for 3 conserved aspartate residues. Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial lytic transglycosylases (LTs), which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond. Typically, peptidoglycan lytic transglycosylases (LT) are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, MltE is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane-bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and Family 4 of bacteriophage origin. While most of the LT family members are similar in structure and sequence with a lysozyme-like fold, Family 2 (including mltA) is distinct.
smart00925	MltA	4.74e-59	126	260	1	153	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
cd14668	mlta_B	1.43e-52	127	262	1	159	Domain B insert of mltA_like lytic transglycosylases. Escherichia coli MltA is a membrane-bound lytic transglycosylase comprised of two domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, which correspond to the 3D domain, named for 3 conserved aspartate residues. Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial lytic transglycosylases (LTs), which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond. Typically, peptidoglycan lytic transglycosylases (LT) are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, MltE is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane-bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and Family 4 of bacteriophage origin. While most of the LT family members are similar in structure and sequence with a lysozyme-like fold, Family 2 (including mltA) is distinct.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIE97144.1	5.72e-262	3	383	2	382
AYP22185.1	8.12e-262	3	383	2	382
AOE38923.1	8.12e-262	3	383	2	382
QAV50565.1	8.12e-262	3	383	2	382
QGY57090.1	8.12e-262	3	383	2	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GAE_A	6.97e-191	21	363	1	341	Crystalstructure of MltA from E. coli [Escherichia coli]
2AE0_X	6.39e-189	23	363	2	340	Crystalstructure of MltA from Escherichia coli reveals a unique lytic transglycosylase fold [Escherichia coli]
2PJJ_A	1.05e-187	23	363	2	340	ChainA, Membrane-bound lytic murein transglycosylase A [Escherichia coli K-12]
2PIC_A	2.12e-187	23	363	2	340	ChainA, Membrane-bound lytic murein transglycosylase A [Escherichia coli K-12]
2PI8_A	3.66e-181	23	363	2	340	Crystalstructure of E. coli MltA with bound chitohexaose [Escherichia coli K-12],2PI8_B Crystal structure of E. coli MltA with bound chitohexaose [Escherichia coli K-12],2PI8_C Crystal structure of E. coli MltA with bound chitohexaose [Escherichia coli K-12],2PI8_D Crystal structure of E. coli MltA with bound chitohexaose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A935	3.98e-199	3	363	2	360	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=mltA PE=1 SV=1
P0A936	3.98e-199	3	363	2	360	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli O157:H7 OX=83334 GN=mltA PE=3 SV=1
P57531	7.41e-121	28	356	28	356	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) OX=107806 GN=mltA PE=3 SV=1
Q8K9A7	1.05e-114	24	357	32	365	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) OX=198804 GN=mltA PE=3 SV=1
Q9KPQ4	1.36e-102	7	356	2	349	Membrane-bound lytic murein transglycosylase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mltA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000073	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002423_01343.