CAZyme Information: MGYG000002423_01733

Basic Information

• Species: Pantoea septica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea septica
• CAZyme ID: MGYG000002423_01733
• CAZy Family: GH15
• CAZyme Description: Trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604	MGYG000002423_2|CGC22	68816.75	5.1522

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002423	4877109	Isolate	United States	North America

• Gene Location: Start: 1822344; End: 1824158 Strand: -

Full Sequence      

MSTIKRPIEDHGIIGDLRTCALVANDGTIDYLCWPALDSPSVFAALLDSDDAGLFSLAPE
WENVRRQQLYLPDTNILQTRWLGAEGVAEITDYMPICDDAKKQPRLVRRIKMVRGSAWFN
MRCAPRHDYARAETRAQAAGDCIDFYAQNQPTLRLAATVPLTCEADAATARFELQSGEHV
EFEFGNQEDARIGDVATEVCFEETLDYWRRWSKKSNYSGRWQEMVQRSALALKLLTSSQH
GSIAAAATFGLPEELGGVRNWDYRASWIRDASFSMYALMRLGYVDEAKHFTRWVGRCVEN
SHHDEMRLQVMYRLDSGIELHEIELLNLSGYADSRPVRIGNDAWQQTQLDIYGELMDAVY
LANKYGEAISERGWQHVAQMIDMVCESWNQPDAGIWEMRGEPEHFLHSRLMCWVALDRAL
RLGMKRSLPMPYARWDSARSEIRADIWQNFWNAERGHFVSTRHGDHLDASMLLMPLVRFV
GATDPEWLSTLDAIKRELVSDGMVRRYNIDETPADGLTGSEGSFGACSFWYVECLARAGR
IHEAHFEFEKLLSYANPLGLYAEEFDNHGRALGNMPQALTHLALISAAFFLNRKLSGEVT
LWQP

Enzyme Prediction     

No EC number prediction in MGYG000002423_01733.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	222	588	1.1e-73	0.9916897506925207

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3387	SGA1	1.64e-106	6	588	14	601	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
pfam00723	Glyco_hydro_15	1.86e-64	219	589	1	417	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
TIGR01577	oligosac_amyl	1.81e-08	188	510	215	524	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYP23949.1	0.0	1	604	1	604
ADO08816.1	0.0	1	604	1	604
QCA05091.1	0.0	1	604	1	604
QPG26132.1	0.0	1	604	1	604
AVV37134.1	0.0	1	604	1	604

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10211	2.86e-140	4	596	15	644	Uncharacterized protein C4H3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.03c PE=4 SV=1
A0R0W9	8.54e-125	7	587	41	644	Trehalase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4535 PE=1 SV=1
P71741	3.34e-124	7	587	53	656	Trehalase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2402 PE=1 SV=2
Q978S7	6.61e-107	8	588	30	607	Trehalase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) OX=273116 GN=TVG1381191 PE=1 SV=1
Q9HLE2	4.54e-102	22	588	2	565	Trehalase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) OX=273075 GN=Ta0286 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002423_01733.