CAZyme Information: MGYG000002423_01995

Basic Information

• Species: Pantoea septica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea septica
• CAZyme ID: MGYG000002423_01995
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000002423_2|CGC26	43834.92	5.2268

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002423	4877109	Isolate	United States	North America

• Gene Location: Start: 2102439; End: 2103578 Strand: -

Full Sequence      

MTVFPVKQSALLCQPEFLLPRRELLQLIHKLTQNLVNITDETGEFLLHLDDGRVIDTKGW
AGWEWTHGIGLYGMLHYYQQTGDQQTLSIIDDWFAARLEEGTPTKNVNTVAPFLTLAYRY
EETGNAAWRPVLERWAEWVMYEMPRTEQGGLQHIVYNNENHQQLWDDTLMMSVMALAKIG
QLLNRQEFIEEASYQFLLHTQYLMDRQTGLWFHGWNFEGRHNFANARWARGNSWLTIVIP
DFLEMMNWPEQHATRRFLLQVLESQVKALRACQHPSGLWHTLLDDPDSYLEASATAGFAY
GIIKAVRKRYLSADYLPTGLNALRGVIANIDEDGELKQVSFGTAMGSDLDYYRNVPLTSM
PYGQAMALLCLTEYLRVYL

Enzyme Prediction     

No EC number prediction in MGYG000002423_01995.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	60	376	4.3e-114	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.55e-126	30	379	3	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.87e-120	37	378	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU68808.1	1.98e-258	1	379	1	379
QPG25852.1	2.81e-258	1	379	1	379
QCA04773.1	1.14e-257	1	379	1	379
AIR86652.1	1.14e-257	1	379	1	379
AMG58274.1	2.30e-257	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	7.45e-198	3	378	5	380	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	4.23e-195	3	378	6	381	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	5.76e-138	28	379	12	373	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	5.62e-23	63	373	39	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.37e-22	63	373	29	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.36e-54	63	376	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	3.08e-22	63	373	39	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.00e-10	180	359	10	212	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.00e-10	180	359	10	212	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002423_01995.