CAZyme Information: MGYG000002423_02662

Basic Information

• Species: Pantoea septica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea septica
• CAZyme ID: MGYG000002423_02662
• CAZy Family: GT17
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	MGYG000002423_2|CGC33	35454.67	8.0634

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002423	4877109	Isolate	United States	North America

• Gene Location: Start: 2808286; End: 2809176 Strand: -

Full Sequence      

MIYDCFLYYDEDMLLELRLNTLYEHVDKFVIVESLYTFTGKRREKLNFDIEKFEPFRDKI
IYVVNDAVPKIYSHSFYSNSSLVKAGESDPWENETIARNAIMHGLTGARDSDIIMVSDVD
EIPRPEALRQFSAAHLCTTLYQNFYNFKFNVQVLNEDGSQRLCRLPKMTTFKHLKGFFRG
QPELLRNVKRKGTPIRDCWWRWKLLKLRTRTIENAGWHFSWVMDDARISEKMATISHTEH
NLPKFNNPDHIRRCVEQNVDIWNRPRKMVIRPMTKEYMPEWLVENQHRFADYIEPL

Enzyme Prediction     

No EC number prediction in MGYG000002423_02662.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	2	290	2.9e-64	0.9119718309859155

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04724	Glyco_transf_17	4.99e-18	2	289	75	338	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPG28865.1	1.07e-188	1	294	1	294
AVV37911.1	1.52e-188	1	294	1	294
QGF28791.1	5.09e-164	1	294	1	294
QXG56372.1	1.20e-162	1	294	1	294
QAV49852.1	3.42e-162	1	294	1	294

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002423_02662.