CAZyme Information: MGYG000002423_02827

Basic Information

• Species: Pantoea septica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea septica
• CAZyme ID: MGYG000002423_02827
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
155		16701.33	9.6101

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002423	4877109	Isolate	United States	North America

• Gene Location: Start: 2957442; End: 2957909 Strand: -

Full Sequence      

MSMIIPLLNFEEGFRASPYIDTEGYPTVGVGFLIGPKGASVSNYTFSLTKNVSDVWLQEL
VNSKLSDMKAQPSIAAALKQCNPARADVLLSMAYQMGVDGLAGFKNTLAMITAGNFTGAA
AGMLNSKWAKQTPKRAQRHAEVMRTGAYDIYKGLI

Enzyme Prediction     

No EC number prediction in MGYG000002423_02827.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	4	135	1.3e-18	0.8832116788321168

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00735	T4-like_lys	3.94e-71	3	149	1	145	bacteriophage T4-like lysozymes. Bacteriophage T4-like lysozymes hydrolyze the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1), as well as Dictyostelium.
PHA02596	5	2.90e-28	4	151	175	336	baseplate hub subunit and tail lysozyme; Provisional
cd00737	lyz_endolysin_autolysin	3.54e-09	12	141	9	131	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd16901	lyz_P1	7.16e-06	12	140	14	137	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam00959	Phage_lysozyme	2.17e-04	25	137	1	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKV87626.1	1.41e-85	1	155	1	155
QBR52735.1	3.39e-77	1	155	1	155
AMG57743.1	3.39e-77	1	155	1	155
AXF75420.1	3.95e-76	1	155	1	155
AUY25508.1	5.36e-74	1	155	1	155

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
159L_A	3.38e-23	4	154	3	164	ChainA, T4 LYSOZYME [Tequatrovirus T4]
192L_A	6.72e-23	4	154	3	164	ChainA, LYSOZYME [Tequatrovirus T4]
1L24_A	9.48e-23	4	154	3	164	ChainA, T4 LYSOZYME [Tequatrovirus T4]
1L22_A	9.48e-23	4	154	3	164	ChainA, T4 LYSOZYME [Tequatrovirus T4]
1L62_A	9.48e-23	4	154	3	164	ChainA, LYSOZYME [Tequatrovirus T4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P00720	7.00e-19	4	154	3	164	Endolysin OS=Enterobacteria phage T4 OX=10665 GN=E PE=1 SV=2
Q556F2	4.43e-18	1	152	2	170	Probable T4-type lysozyme 1 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274831 PE=3 SV=1
P16009	1.40e-14	7	151	179	339	Pre-baseplate central spike protein Gp5 OS=Enterobacteria phage T4 OX=10665 GN=5 PE=1 SV=2
Q86AA1	8.83e-13	1	152	2	170	Probable T4-type lysozyme 2 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274291 PE=2 SV=1
Q7Y2C9	7.19e-08	12	137	753	871	Peptidoglycan hydrolase gp36 OS=Pseudomonas phage phiKMV OX=204270 GN=gp36 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002423_02827.