CAZyme Information: MGYG000002423_03878

Basic Information

• Species: Pantoea septica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Pantoea; Pantoea septica
• CAZyme ID: MGYG000002423_03878
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
165		18950.88	10.1912

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002423	4877109	Isolate	United States	North America

• Gene Location: Start: 43955; End: 44452 Strand: +

Full Sequence      

MFIYSRCSPAGDRHFLRQRECGLFIKAGEWYSIDPDYLRAIAWQESRYNPAAVNTNRTKD
GKPGSSDYGLMQINSVTMRRLQKEYPGLSKEKLLSEPCLNIYIGAMLLRRNFNQYGTTWL
AVGMYNAGMKNLPVTVTNRYNYAMLIDKHYKAIKSGKIPRKAFSG

Enzyme Prediction     

No EC number prediction in MGYG000002423_03878.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	34	132	1.8e-17	0.6222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	9.39e-44	31	151	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	2.50e-28	26	154	24	143	type III secretion system invasion protein IagB.
pfam01464	SLT	7.24e-25	24	128	1	95	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	3.28e-23	24	157	23	149	lytic transglycosylase; Provisional
COG0741	MltE	4.26e-14	23	160	142	266	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAV47616.1	8.75e-101	24	165	25	166
QAV52180.1	8.75e-101	24	165	25	166
QDY44254.1	8.04e-97	24	165	25	166
QHM74036.1	1.39e-85	2	160	43	201
QGY32547.1	8.05e-67	24	163	25	164

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	1.75e-09	24	111	4	85	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P17738	6.52e-24	24	157	23	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
Q00739	6.52e-24	24	157	23	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P14499	1.83e-23	1	157	11	149	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
E1WAC2	2.06e-23	24	161	22	150	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	2.06e-23	24	161	22	150	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999708	0.000329	0.000013	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002423_03878.