CAZyme Information: MGYG000002424_02097

Basic Information

• Species: Monoglobus pectinilyticus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae; Monoglobus; Monoglobus pectinilyticus
• CAZyme ID: MGYG000002424_02097
• CAZy Family: CBM6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1367	MGYG000002424_1|CGC29	152085.05	4.4554

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002424	2757122	Isolate	New Zealand	Oceania

• Gene Location: Start: 2486549; End: 2490652 Strand: -

Full Sequence      

MKGLFKRLMGVFVIVSLVCSTFAVPIEVNAASDTQQVDGTTGTPLGGFGTGGVKFNARLG
SFAALTKAPADANDYTALKDAKFQLYTNRNGSIKTVDTMKSASSNGRSEDDAIWPMHFAN
MGSTNDVQVNLKAFSPLDNVDYDNMSMPYAFYEMTLENLGDTSVDASCAFQLTTNDIPAL
VDGKGFNGKKWAIYGNSEQNGAIVSVGNNSDFNTTGVLDNSISGKTNKVAVKVNLDAKQS
TVIRFVLAWYDDSEPDWHYYLNLYNNPGDIAARGLEKFDTLKNNAETLVTKMRDSNLPDW
FRNQIQNTLVNISNNSMYKKDGRVAYSEGQWTCFGTMDQMWQARQVIAQFIPFFAWRELE
YWARTQRNDGQIHHDFNTAVENKADRAELVDWDYTEHPDYRNVDKWVDLNCGLIISVYET
MQVAGNPSTDGIILGKDPIPEGTTMLDYFWPYLKKAGDRILKQVELYGNKTYPYTFDNSE
NSYDAGGNPNPYNASVSAVAYKIMARLADEMGETEEAAKYTTAYNTVTDSFAKRYLSNNF
PEDKRVSESFLTGQWLSLHLKLGQIWTDEQTDYALSELDSFYHPYYWGMGTLKGTYNEWT
PYTLMHYGGLLLQTRRENIFEAMQRDSYNRQYTDRNKVFNHPLDILPAVNTPNYAATTIS
GDKQYISMPGLWRNYNDVVGYYRDQRTKDIWVQPRLLPEMNNVMTDGMFVMPEGYGTVSC
VESGEANQNQNMTVKSDNPIAVKNIHLSDNFGETNPVVQINGQPVNFTRTGTGYDKELVV
EWNGTLDSTGITIETSGEAGYTVPALPEKPDHGPDDKPSGEVKNPYESISATSAEGKVKV
DVETPMGQDWFVRNQFNYDSHIIFENVDFGDVGSNMISARVASVDSGFTLQVKLDAVSND
IIGTIEVPNTGNEQTWKEASCTLNETVKGKHDVIIVFDAAGASGEDAKFVNLNSIKFLQA
DGRLDRSAWKGSASNNSSSTFAAWDGDLETKWHCSWQEVGKYMTINFGKTEKFNKIVIDN
NTKTTDHPKGYALYVSNDGKNFGDPIVTGNPEQDTKLVIEFPEQQAQYIKIVITEANSSK
YWAVNELNVFMEKEPEPEETDPAQVGVFSGTSSNHPTGTKYFNITKNDLGSKPARVNSNT
ERAKFVDGIDAKVKAIFADKTDETLLREKFTQTFVNYIGKSGDYDVKPTIADISLPAGKY
SIYYFGGEDLPVIVDLPDAAPGMVTVDASKPSYAFATIGTKTHNMKEISLTVNQDYTGDI
TFYNENGWLPDLYSLVIMNDNAPQPQPVTEITGYSKDTGVVSISRGEDFPENAVVVAAGY
TNDVLTDVKYAAVGSSNEIEVGTVAGDTVKVYLWDSLENMNPLCEAY

Enzyme Prediction     

No EC number prediction in MGYG000002424_02097.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM6	838	957	1.9e-19	0.7898550724637681
CBM32	971	1087	4.1e-19	0.9032258064516129

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04084	CBM6_xylanase-like	7.39e-22	829	957	3	123	Carbohydrate Binding Module 6 (CBM6); many are appended to glycoside hydrolase (GH) family 11 and GH43 xylanase domains. This family includes carbohydrate binding module 6 (CBM6) domains that are appended mainly to glycoside hydrolase (GH) family domains, including GH3, GH11, and GH43 domains. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB6s belonging to this family are Microbispora bispora GghA, a 1,4-beta-D-glucan glucohydrolase (GH3); Clostridium thermocellum xylanase U (GH11), and Penicillium purpurogenum ABF3, a bifunctional alpha-L-arabinofuranosidase/xylobiohydrolase (GH43). GH3 comprises enzymes with activities including beta-glucosidase (hydrolyzes beta-galactosidase) and beta-xylosidase (hydrolyzes 1,4-beta-D-xylosidase). GH11 family comprises enzymes with xylanase (endo-1,4-beta-xylanase) activity which catalyze the hydrolysis of beta-1,4 bonds of xylan, the major component of hemicelluloses, to generate xylooligosaccharides and xylose. GH43 includes beta-xylosidases and beta-xylanases, using aryl-glycosides as substrates. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold.
COG4354	COG4354	3.20e-17	42	582	14	614	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
smart00606	CBD_IV	6.91e-17	862	957	42	129	Cellulose Binding Domain Type IV.
pfam03422	CBM_6	2.52e-16	862	957	34	123	Carbohydrate binding module (family 6).
pfam00754	F5_F8_type_C	9.87e-16	972	1083	3	122	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO20229.1	0.0	1	1367	1	1367
QCP10011.1	2.44e-293	37	937	40	925
ALJ61438.1	1.53e-289	33	957	40	947
QUT92987.1	1.53e-289	33	957	40	947
QBI01799.1	1.78e-287	37	957	41	942

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2V4V_A	1.99e-15	826	959	4	129	CrystalStructure of a Family 6 Carbohydrate-Binding Module from Clostridium cellulolyticum in complex with xylose [Ruminiclostridium cellulolyticum]
7DKS_A	1.58e-09	127	581	155	684	ChainA, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKT_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKU_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],7DKV_A Chain A, beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11]
5FJS_A	2.06e-09	127	581	151	680	Bacterialbeta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5FJS_B Bacterial beta-glucosidase reveals the structural and functional basis of genetic defects in human glucocerebrosidase 2 (GBA2) [Thermoanaerobacterium xylanolyticum LX-11],5O0S_A Crystal structure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with unreacted beta Cyclophellitol Cyclosulfate probe ME711 [Thermoanaerobacterium xylanolyticum LX-11]
5NPF_A	2.07e-09	127	581	154	683	Crystalstructure of txGH116 (beta-glucosidase from Thermoanaerobacterium xylolyticum) in complex with beta Cyclophellitol Cyclosulfate probe ME594 [Thermoanaerobacterium xylanolyticum]
5BVU_A	2.08e-09	127	581	155	684	Crystalstructure of Thermoanaerobacterium xylolyticum GH116 beta-glucosidase [Thermoanaerobacterium xylanolyticum LX-11],5BX2_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with 2-deoxy-2-fluoroglucoside [Thermoanaerobacterium xylanolyticum LX-11],5BX3_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with deoxynojirimycin [Thermoanaerobacterium xylanolyticum LX-11],5BX4_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with Glucoimidazole [Thermoanaerobacterium xylanolyticum LX-11],5BX5_A Crystal structure of Thermoanaerobacterium xylanolyticum GH116 beta-glucosidase with glucose [Thermoanaerobacterium xylanolyticum LX-11],5NCX_A Crystal structure of Thermoanaerobacterium xylolyticum GH116 beta-glucosidase with an covalent inhibitor [Thermoanaerobacterium xylanolyticum LX-11],5OST_A Beta-glucosidase from Thermoanaerobacterium xylolyticum GH116 in complex with Gluco-1H-imidazole [Thermoanaerobacterium xylanolyticum LX-11]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45796	1.93e-09	824	962	376	512	Arabinoxylan arabinofuranohydrolase OS=Paenibacillus polymyxa OX=1406 GN=xynD PE=1 SV=1
Q45071	7.56e-08	824	941	379	498	Arabinoxylan arabinofuranohydrolase OS=Bacillus subtilis (strain 168) OX=224308 GN=xynD PE=1 SV=2
P33558	5.19e-07	864	937	426	496	Endo-1,4-beta-xylanase A OS=Thermoclostridium stercorarium OX=1510 GN=xynA PE=1 SV=2
Q8GJ44	6.10e-07	864	937	565	635	Endo-1,4-beta-xylanase A OS=Thermoclostridium stercorarium OX=1510 GN=xynA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000233	0.999068	0.000192	0.000170	0.000163	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002424_02097.